[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56279.1
DDBJ      :             phosphotransferase LicD3
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  46/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.218.1
:281 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   232->276 1j1lA PDBj 8e-04 40.0 %
:RPS:SCOP  10->89 2ewrA1  d.218.1.11 * 2e-08 11.7 %
:RPS:PFM   26->129 PF04991 * LicD 4e-16 48.4 %
:RPS:PFM   211->237 PF06901 * FrpC 2e-04 51.9 %
:HMM:PFM   25->246 PF04991 * LicD 1.8e-37 32.2 183/191  
:BLT:SWISS 7->261 LICD_HAEIN 2e-23 31.1 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56279.1 GT:GENE ACF56279.1 GT:PRODUCT phosphotransferase LicD3 GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1274325..1275170) GB:FROM 1274325 GB:TO 1275170 GB:DIRECTION - GB:PRODUCT phosphotransferase LicD3 GB:NOTE identified by match to protein family HMM PF04991 GB:PROTEIN_ID ACF56279.1 GB:DB_XREF GI:194357831 LENGTH 281 SQ:AASEQ MNNMTDLKAIQARSLEMAEYFVAFCKEHDLLCYLCGGGAIGTLRNKGFIPWDDDLDFFMPRKDYEKLAELWPRYADERYFLSKSHKDFVDRNLFITIRDKKTTCIKPYQQDLDLPHGLALDVLPLDYYPKNPAERKKQVRWALIYSLFCAQTIPEKHGALMKWGSRILLGLTPKSLRYRIWKKAEKEMTKYDLADCDGITELCSGPGYMRNKYPITSFEDNLFFPFEGTEMPIPIGYDVYLRTAFGDYMTPPPADKQVPHHDAVIADMDKSYTEYKGEYGG GT:EXON 1|1-281:0| BL:SWS:NREP 1 BL:SWS:REP 7->261|LICD_HAEIN|2e-23|31.1|241/265| BL:PDB:NREP 1 BL:PDB:REP 232->276|1j1lA|8e-04|40.0|45/282| RP:PFM:NREP 2 RP:PFM:REP 26->129|PF04991|4e-16|48.4|91/145|LicD| RP:PFM:REP 211->237|PF06901|2e-04|51.9|27/271|FrpC| HM:PFM:NREP 1 HM:PFM:REP 25->246|PF04991|1.8e-37|32.2|183/191|LicD| RP:SCP:NREP 1 RP:SCP:REP 10->89|2ewrA1|2e-08|11.7|77/156|d.218.1.11| OP:NHOMO 90 OP:NHOMOORG 47 OP:PATTERN --------------------------------3----------------------------------- ------------------------------------------------------------------------------2242---------2-3---------------------------------------------------------------------------------------------------------------------------------------------------------------2-11--1----11------11--1--111----1--33334333433-------------1-------------1-------1--------11------42-----------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-2-22--------------------------------------------------1---------------------------------------------------------------------------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 45 STR:RPRED 16.0 SQ:SECSTR #######################################################################################################################################################################################################################################EccTTcEEEEEEEEccEEccTTccEEETTEEEEEccccEEEEEcc##### DISOP:02AL 1-5,255-255,277-278,280-282| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHccccEEEEccHHHHHHHHccccccccccEEcccHHHHHHHHHHHHHHccccEEEEcccccccccccEEEEccccccccccccccccccccEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccEEcccccccHHHcccccccccccccHHHccccEEEEEccEEEEccccHHHHHHHHHHHHcccccHHHccccccEEEEccccccHHccccccc //