[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56288.1
DDBJ      :             ABC transporter, ATP-binding protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  43/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:255 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   135->247 1oedC PDBj 2e-05 32.7 %
:BLT:SWISS 164->251 SOTB_HAEI8 2e-04 37.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56288.1 GT:GENE ACF56288.1 GT:PRODUCT ABC transporter, ATP-binding protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 1567298..1568065 GB:FROM 1567298 GB:TO 1568065 GB:DIRECTION + GB:PRODUCT ABC transporter, ATP-binding protein GB:PROTEIN_ID ACF56288.1 GB:DB_XREF GI:194357840 LENGTH 255 SQ:AASEQ MFWNLVRYEFKNVNKWYLALYAAVLVLSALIGIQTQGFKNLPYQXSQATMLLFLATVFGGLMLTLGISTIFLIIKRFKGSVYDRQGYLTLTLPVSEHHIITAKLIGAFIWSLISTAVLALSAVIILALTAPEWIPLSYVITFVETHLPQIFLTGISFLLNTISGILCIYLAISIGQLFNEYRTALAVAVYIGIQIVIGFIELFFNLSSNFYVNSLVGLNDHFYMGAGIAIVEELIFIAIFYLGTYYILRNKVNLL GT:EXON 1|1-255:0| BL:SWS:NREP 1 BL:SWS:REP 164->251|SOTB_HAEI8|2e-04|37.3|83/402| TM:NTM 6 TM:REGION 14->36| TM:REGION 52->74| TM:REGION 104->126| TM:REGION 153->175| TM:REGION 183->205| TM:REGION 228->249| SEG 17->30|ylalyaavlvlsal| SEG 115->130|tavlalsaviilalta| BL:PDB:NREP 1 BL:PDB:REP 135->247|1oedC|2e-05|32.7|107/127| OP:NHOMO 43 OP:NHOMOORG 43 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111-111111111111111111----------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 113 STR:RPRED 44.3 SQ:SECSTR ######################################################################################################################################cTHHHHHHHHHHHHHHHHHHHHHHHHHHcTHHHHHHHHHHHHHHHHHHHHHHccEEEEEcccTHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHH######## PSIPRED ccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHcccccEEEccEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //