[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56293.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.109.1
:47 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->47 3hiaC PDBj 8e-07 44.2 %
:RPS:SCOP  6->47 2bibA1  b.109.1.1 * 7e-04 34.1 %
:HMM:SCOP  4->47 1h09A1 b.109.1.1 * 7.8e-07 34.1 %
:HMM:PFM   19->36 PF01473 * CW_binding_1 6.4e-09 55.6 18/19  
:BLT:SWISS 5->45 LYTB_STRR6 8e-07 34.1 %
:REPEAT 2|6->26|27->47

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56293.1 GT:GENE ACF56293.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1743233..1743376) GB:FROM 1743233 GB:TO 1743376 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE identified by match to protein family HMM PF01473 GB:PROTEIN_ID ACF56293.1 GB:DB_XREF GI:194357845 LENGTH 47 SQ:AASEQ MILDSFFAFNCSGTMKVSTWVYDKGEWYYVSSSGSMIANDWVKDNGK GT:EXON 1|1-47:0| BL:SWS:NREP 1 BL:SWS:REP 5->45|LYTB_STRR6|8e-07|34.1|41/702| NREPEAT 1 REPEAT 2|6->26|27->47| BL:PDB:NREP 1 BL:PDB:REP 5->47|3hiaC|8e-07|44.2|43/74| HM:PFM:NREP 1 HM:PFM:REP 19->36|PF01473|6.4e-09|55.6|18/19|CW_binding_1| RP:SCP:NREP 1 RP:SCP:REP 6->47|2bibA1|7e-04|34.1|41/232|b.109.1.1| HM:SCP:REP 4->47|1h09A1|7.8e-07|34.1|44/0|b.109.1.1|1/1|Cell wall binding repeat| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-11-11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 46 STR:RPRED 97.9 SQ:SECSTR #ETTEEEEEcTTccccccEEEEETTEEEEEcTTcccccccccccccc DISOP:02AL 45-48| PSIPRED ccEEEEEEEEccccEEEEEEEEEccEEEEEEccccEEEcHHHHcccc //