[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56297.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  123/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:317 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   144->226 3btaA PDBj 3e-04 11.5 %
:RPS:PFM   23->141 PF06081 * DUF939 4e-08 32.8 %
:RPS:PFM   145->308 PF11728 * DUF939_C 6e-30 44.5 %
:HMM:PFM   145->309 PF11728 * DUF939_C 6.1e-56 41.2 165/167  
:HMM:PFM   1->141 PF06081 * DUF939 8.4e-45 49.6 141/141  
:BLT:SWISS 24->311 YQJA_BACSU 3e-37 28.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56297.1 GT:GENE ACF56297.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 1605918..1606871 GB:FROM 1605918 GB:TO 1606871 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE identified by match to protein family HMM PF06081 GB:PROTEIN_ID ACF56297.1 GB:DB_XREF GI:194357849 LENGTH 317 SQ:AASEQ MSISQRTTKLILATCLACLLAYFLNLSSAVSAGIIALLSLSDTRXRTLKLARNRLFSMLLALAIGVLAFHLSGFHIWSLGLYLAFYVPLAYKMGWEIGITPSTVLVSHLLVQESTSPDLLVNEFLLFAIGTGFALLVNLYMPSREEEIQHYHTLVEEKLKDILQRFKYYLSRGDGRNRAQLVAELDTLLKEALRLVYLDHSDHLFHQTDYHIHYFEMRQRQSRILRNMAQQINTCHLAASESLILAQLFSKIAGQLSQTNPASDLLDEIERYLEVFRNRSLPKTREEFETRATLLQLLREAKTFIQVKVDFYQKYRQ GT:EXON 1|1-317:0| BL:SWS:NREP 1 BL:SWS:REP 24->311|YQJA_BACSU|3e-37|28.8|288/100| TM:NTM 3 TM:REGION 12->34| TM:REGION 61->83| TM:REGION 119->140| SEG 7->21|ttklilatclaclla| SEG 37->50|llslsdtrxrtlkl| RP:PDB:NREP 1 RP:PDB:REP 144->226|3btaA|3e-04|11.5|78/1277| RP:PFM:NREP 2 RP:PFM:REP 23->141|PF06081|4e-08|32.8|119/140|DUF939| RP:PFM:REP 145->308|PF11728|6e-30|44.5|164/168|DUF939_C| HM:PFM:NREP 2 HM:PFM:REP 145->309|PF11728|6.1e-56|41.2|165/167|DUF939_C| HM:PFM:REP 1->141|PF06081|8.4e-45|49.6|141/141|DUF939| OP:NHOMO 123 OP:NHOMOORG 123 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111111111111111111111111111111111111111111111111111111---11---------11------------11111--111111111111111111111111111---1111---111111111111-1---11111-11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 78 STR:RPRED 24.6 SQ:SECSTR ###############################################################################################################################################ccccccccccccc####ccccTTTTHHHHHHHHHHHHTcHHHHHHHHHHHHTTccTT#cccccGGGEEEEEcTTccEEEEEcc########################################################################################### DISOP:02AL 1-1,317-318| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHcccEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //