[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56302.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  402/915 : Eukaryota  44/199 : Viruses  0/175   --->[See Alignment]
:227 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   15->224 PF01027 * UPF0005 3e-18 37.4 %
:HMM:PFM   15->224 PF01027 * UPF0005 2.5e-34 32.8 198/203  
:BLT:SWISS 1->227 Y358_STRP1 1e-64 52.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56302.1 GT:GENE ACF56302.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1788462..1789145) GB:FROM 1788462 GB:TO 1789145 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE identified by match to protein family HMM PF01027 GB:PROTEIN_ID ACF56302.1 GB:DB_XREF GI:194357854 LENGTH 227 SQ:AASEQ MNHTIIHDRAGLNQFYAKVYAFVGLGIGLSALVSGLMLTVFQSQLVYLLMQGRLWLTIATFAELALVFVASSMASRNSPAALPVFLLYSVLNGFTLSFVVAFYTPGTVLSAFVSSALLFFVMAAVGIFTKKDLSGIGRAMMAALIGLLIAMVVNIFLASGFFDYMISVAMVLVFSGLIAWDNQKIRLAYEQSQGRVATGWVVSMALSIYLDFINLFLSILRIFGRND GT:EXON 1|1-227:0| BL:SWS:NREP 1 BL:SWS:REP 1->227|Y358_STRP1|1e-64|52.4|227/229| TM:NTM 7 TM:REGION 21->43| TM:REGION 53->75| TM:REGION 79->101| TM:REGION 106->128| TM:REGION 132->154| TM:REGION 159->181| TM:REGION 199->221| SEG 139->151|ammaaliglliam| RP:PFM:NREP 1 RP:PFM:REP 15->224|PF01027|3e-18|37.4|198/200|UPF0005| HM:PFM:NREP 1 HM:PFM:REP 15->224|PF01027|2.5e-34|32.8|198/203|UPF0005| OP:NHOMO 474 OP:NHOMOORG 446 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------1111111----------------11-------------111111111111111------1----1-----------------------------------------------111-------------------------------------------------------------------1111111121211221111111111111111111111111111111111111111111111111111111---1--------------------------------------------11---111411111112121111111111111111111-112112111211211222122211111-12-12222111111111111-11111111111111111111111111111111111111211-----1121111111111111111111111-11--1111-111---111-----------------------11111111111111111----1111-1---11----11111-1111111111-1-211------1--1-1-----11----1----11-------------11111111111111111-11111111111111111111111111111111111111-1-11111111111-111111111111111----11-----------------------------------------------------------------------------------------------------11111111----------------------------------------- --------------1-----1--1-11------1111------111-1--1111--111111-------------------------1-1----1----1-1-111----------1------1-1------------1-1---1--------------11---1--------11-1------------1--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,191-193,226-228| PSIPRED ccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //