[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56311.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:91 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   7->83 PF09234 * DUF1963 0.00025 20.8 77/224  
:BLT:SWISS 28->74 RIR1_AQUAE 2e-05 38.3 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56311.1 GT:GENE ACF56311.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 1882020..1882295 GB:FROM 1882020 GB:TO 1882295 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF56311.1 GB:DB_XREF GI:194357863 LENGTH 91 SQ:AASEQ MLFSVPYIPHKQLLELWGHGANKVDVDSKENRGRYVTKYFEKGIGQELLENFGKQAYFSSRNLKKPDEDKFYTYEDFNYDSSVVLYETEYN GT:EXON 1|1-91:0| BL:SWS:NREP 1 BL:SWS:REP 28->74|RIR1_AQUAE|2e-05|38.3|47/100| HM:PFM:NREP 1 HM:PFM:REP 7->83|PF09234|0.00025|20.8|77/224|DUF1963| OP:NHOMO 7 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------1---------------------------1---1-------11--1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 91-92| PSIPRED cEEEcccccHHHHHHHHHcccEEEEEEcccccHHHHHHHHHccHHHHHHHHcccEEEEEEccccccHHHEEcccccccccccEEEEEEccc //