[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56329.1
DDBJ      :             Tn5251 hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  18/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:104 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->77 2k5dA PDBj 5e-04 32.4 %
:RPS:PFM   3->101 PF06125 * DUF961 2e-23 60.8 %
:HMM:PFM   2->102 PF06125 * DUF961 4.9e-43 56.0 100/105  
:BLT:SWISS 1->101 YDCP_BACSU 2e-09 39.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56329.1 GT:GENE ACF56329.1 GT:PRODUCT Tn5251 hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1208646..1208960) GB:FROM 1208646 GB:TO 1208960 GB:DIRECTION - GB:PRODUCT Tn5251 hypothetical protein GB:NOTE identified by match to protein family HMM PF06125 GB:PROTEIN_ID ACF56329.1 GB:DB_XREF GI:194357881 LENGTH 104 SQ:AASEQ MELKFVIPNMEKTFGNLEFAGEDKVVQRRINGRLTVLSRSYNLYSDVQRADDIVVVLPAEAGEKHFGFEERVKLVNPRITAEGYKIGTRGFTNYLLHADDMXKE GT:EXON 1|1-104:0| BL:SWS:NREP 1 BL:SWS:REP 1->101|YDCP_BACSU|2e-09|39.0|100/126| BL:PDB:NREP 1 BL:PDB:REP 6->77|2k5dA|5e-04|32.4|71/110| RP:PFM:NREP 1 RP:PFM:REP 3->101|PF06125|2e-23|60.8|97/101|DUF961| HM:PFM:NREP 1 HM:PFM:REP 2->102|PF06125|4.9e-43|56.0|100/105|DUF961| OP:NHOMO 24 OP:NHOMOORG 18 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----1----------1-------2-------------------------1------------211-11-1--------------11---2-1----1-------1----4----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 71 STR:RPRED 68.3 SQ:SECSTR #####cccccGGGcccEEEEEEEEEEEEcTTccEEEEEEEEEEEcccc#ccEEEEEEETTcccccccTTcEEEEccc########################### DISOP:02AL 1-1,104-105| PSIPRED cccEEEEEcHHHccccEEEEEEEEEEEEEcccccEEEEEEEEEEcccccccEEEEEEccccccccccccccEEEEccEEEEEEEEEEcccEEEEEEEEcccccc //