[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56333.1
DDBJ      :             ribosomal large subunit pseudouridine synthase, RluD subfamily
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  903/915 : Eukaryota  180/199 : Viruses  0/175   --->[See Alignment]
d.265.1d.66.1
:298 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   78->293 1xpiB PDBj 7e-30 40.4 %
:RPS:PDB   8->290 3dh3B PDBj 1e-30 20.1 %
:RPS:SCOP  8->95 1dm9A  d.66.1.3 * 2e-07 13.8 %
:RPS:SCOP  78->292 1v9kA  d.265.1.3 * 4e-54 37.1 %
:HMM:SCOP  67->294 1przA_ d.265.1.3 * 2.1e-67 41.8 %
:RPS:PFM   86->235 PF00849 * PseudoU_synth_2 3e-22 45.1 %
:HMM:PFM   84->235 PF00849 * PseudoU_synth_2 6.9e-35 33.8 151/164  
:BLT:SWISS 13->290 YJBO_BACSU 2e-60 46.5 %
:PROS 127->141|PS01129|PSI_RLU

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56333.1 GT:GENE ACF56333.1 GT:PRODUCT ribosomal large subunit pseudouridine synthase, RluD subfamily GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 978545..979441 GB:FROM 978545 GB:TO 979441 GB:DIRECTION + GB:PRODUCT ribosomal large subunit pseudouridine synthase, RluD subfamily GB:NOTE identified by match to protein family HMM PF00849; match to protein family HMM TIGR00005 GB:PROTEIN_ID ACF56333.1 GB:DB_XREF GI:194357885 LENGTH 298 SQ:AASEQ MRFEFIADEHVKVKTFLKKHEVSKGLLAKIKFRGGAILVNNQPQNATYLLDVGDYVTIYIPAEEGFETLEAIEHPLDILYEDDHFLVLNKPYGVASIPSVNHSNTIANFIKGYYVKQNYENQQVHIVTRLDRDTSGLMLFAKHGYAHARLDKQLQKKSIEKRYFALVKGDGHLEPEGEIIAPIARDEDSIITRRVAKGGKYAHTSYKIVASYGNIHLVYIHLHTGRTHQIRVHFSYIGFPLLGDDLYGGSLEDGIQRQALHCHYLSFYHPFLEQDLQLESPLPDDFSNLITQLSTNTL GT:EXON 1|1-298:0| BL:SWS:NREP 1 BL:SWS:REP 13->290|YJBO_BACSU|2e-60|46.5|275/283| PROS 127->141|PS01129|PSI_RLU|PDOC00869| BL:PDB:NREP 1 BL:PDB:REP 78->293|1xpiB|7e-30|40.4|208/229| RP:PDB:NREP 1 RP:PDB:REP 8->290|3dh3B|1e-30|20.1|239/241| RP:PFM:NREP 1 RP:PFM:REP 86->235|PF00849|3e-22|45.1|142/149|PseudoU_synth_2| HM:PFM:NREP 1 HM:PFM:REP 84->235|PF00849|6.9e-35|33.8|151/164|PseudoU_synth_2| GO:PFM:NREP 4 GO:PFM GO:0001522|"GO:pseudouridine synthesis"|PF00849|IPR006145| GO:PFM GO:0003723|"GO:RNA binding"|PF00849|IPR006145| GO:PFM GO:0009451|"GO:RNA modification"|PF00849|IPR006145| GO:PFM GO:0009982|"GO:pseudouridine synthase activity"|PF00849|IPR006145| RP:SCP:NREP 2 RP:SCP:REP 8->95|1dm9A|2e-07|13.8|87/104|d.66.1.3| RP:SCP:REP 78->292|1v9kA|4e-54|37.1|210/227|d.265.1.3| HM:SCP:REP 67->294|1przA_|2.1e-67|41.8|225/252|d.265.1.3|1/1|Pseudouridine synthase| OP:NHOMO 2942 OP:NHOMOORG 1088 OP:PATTERN --------------------------------------11111------------------------- 2121122322221221123-41112222222211113233111111311111111212111112212222111111112111111222444414-311122223234424-2222222-211114111111111112222211131223233311222323223112222113111113111132311221433-3333333333333322333333333333223333334533333333333333333333-34344343334444444443333333333333333333333333333333333333333333333333332333333333333343333333334332442133141121212223133214333322222333222332322222222222223-323333332232233222222222334433333333333333333333332334222222222331122222222222222122233333222222223222222222222222222222222232225332333342244332224434444442222549142427222322123333344347776952333333333333333333323433332265654463774599999AA77799-A899A2-3233322122244444554444444444-44444444444444444445553444544444444444444445444444431544444444444222522222222233625555455454554335555454434446434434434-33434332222222225777566666667664322222222222222444422222221221142211112-22221222222222222222222222222232 -1--121-3121222111111111-1111111--1-1111111111111111111111111121122111232222211321112211-22112111-1112131-12714122213-21111112-21392-21211111111-11111211223132--2332114222-1111131E846-233541328642115 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 292 STR:RPRED 98.0 SQ:SECSTR ##TTTTHcccEEHHHHHHTTTcccHHHHHHHHHTTcEEETTEEccTTcEEcccccEEETTEccccTTccccGGEEccccGGGccEEEEEEcTTcccccccccTTccccccTTcHHHHHTcccccEEccccccccEEEEEEEccTHHHHHHHcGGGcTTccEEEEEEEccETTccTTccEETcccHHHHHHHHTcccccccccccEEEEcEEEEcccEEEEEEccccTTHHHHHHHHTTccEEEEEEEEEcccHEETTEEcTTccTTcEEEccHHHHHHHHHTccccccccTTcc#### DISOP:02AL 297-299| PSIPRED cEEEEEccccccHHHHHHHccccHHHHHHHHHHcccEEEccEEEccccEEccccEEEEEEEcccccccccccccEEEEEEEcccEEEEEccccEEEEccccccccHHHHHHHHHHHccccccEEEEEEcccccccEEEEEEccHHHHHHHHHHHHHccccEEEEEEEEccccccccEEEEcccEEcccccEEEEEcccccccccEEEEEEEcccEEEEEEEEcccccHHHHHHHHHccccEEccccccccccccccccEEEEEEEEEcccccccEEEEEccccHHHHHHHHHHccccc //