[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56342.1
DDBJ      :             PTS system,  IIBC component
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  189/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.44.2
:563 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   463->546 3czcA PDBj 4e-04 18.1 %
:HMM:SCOP  461->563 1iibA_ c.44.2.1 * 1e-17 26.3 %
:RPS:PFM   128->330 PF02378 * PTS_EIIC 1e-06 27.8 %
:HMM:PFM   28->347 PF02378 * PTS_EIIC 5.5e-74 29.1 306/321  
:HMM:PFM   463->531 PF02302 * PTS_IIB 2.7e-12 35.8 67/90  
:BLT:SWISS 1->563 PTLCB_LACLA 0.0 73.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56342.1 GT:GENE ACF56342.1 GT:PRODUCT PTS system, IIBC component GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1061289..1062980) GB:FROM 1061289 GB:TO 1062980 GB:DIRECTION - GB:PRODUCT PTS system, IIBC component GB:NOTE identified by match to protein family HMM PF02302; match to protein family HMM PF02378; match to protein family HMM TIGR00394; match to protein family HMM TIGR00410; match to protein family HMM TIGR00853 GB:PROTEIN_ID ACF56342.1 GB:DB_XREF GI:194357894 LENGTH 563 SQ:AASEQ MNKLIAFIEKGKPFFEKLSRNIYLRAIRDGFIAGMPVILFSSIFILIAFVPNSWGFKWSDEVVAFLMKPYSYSMGILALLVAGTTAKSLTDSVNRSMEKTNQINYMSTLLAAIVGLLMLAADPIENGLATGFLGTKGLLSAFLAAFVTVAIYKVCVKNNVTIRMPDXVPPNISQVFKDVIPFTLSVVSLYALDLLARHFVGSSVAESIGKFFAPLFSAADGYLGITIIFGAFAFFWFVGIHGPSIVXPAIAAITYANAEVNLNLLQQGMHADKILTSGTQMFIVTMGGTGATLVVPFMFMWLTKSKRNRAIGRASVVPTFFGVNEPILFGAPLVLNPIFFIPFIFAPIANVWXFKFFIETLGMNSFTANLPWTTPAPLGLVLGTNFQVLSFILAALLIVVDVVIYYPFLKVYDEQILEEERSGKSNDELKEKVAANFNTAKADAILEKAGVDAAQNTITEETNVLVLCAGGGTSGLLANALNKAAAEYNVPVKAAAGGYGAHREMLPEFDLVILAPQVASNFEDMKAETDKLGIKLAKTEGAQYIKLTRDGKGALAFVQAQFD GT:EXON 1|1-563:0| BL:SWS:NREP 1 BL:SWS:REP 1->563|PTLCB_LACLA|0.0|73.0|563/568| TM:NTM 10 TM:REGION 32->54| TM:REGION 62->84| TM:REGION 103->125| TM:REGION 135->157| TM:REGION 175->197| TM:REGION 209->231| TM:REGION 235->257| TM:REGION 279->301| TM:REGION 337->359| TM:REGION 382->404| SEG 38->47|ilfssifili| SEG 224->240|gitiifgafaffwfvgi| SEG 332->351|plvlnpiffipfifapianv| SEG 392->404|ilaallivvdvvi| SEG 476->486|llanalnkaaa| RP:PDB:NREP 1 RP:PDB:REP 463->546|3czcA|4e-04|18.1|83/89| RP:PFM:NREP 1 RP:PFM:REP 128->330|PF02378|1e-06|27.8|187/313|PTS_EIIC| HM:PFM:NREP 2 HM:PFM:REP 28->347|PF02378|5.5e-74|29.1|306/321|PTS_EIIC| HM:PFM:REP 463->531|PF02302|2.7e-12|35.8|67/90|PTS_IIB| GO:PFM:NREP 4 GO:PFM GO:0005351|"GO:sugar:hydrogen symporter activity"|PF02378|IPR003352| GO:PFM GO:0008982|"GO:protein-N(PI)-phosphohistidine-sugar phosphotransferase activity"|PF02378|IPR003352| GO:PFM GO:0009401|"GO:phosphoenolpyruvate-dependent sugar phosphotransferase system"|PF02378|IPR003352| GO:PFM GO:0016020|"GO:membrane"|PF02378|IPR003352| HM:SCP:REP 461->563|1iibA_|1e-17|26.3|99/103|c.44.2.1|1/1|PTS system, Lactose/Cellobiose specific IIB subunit| OP:NHOMO 506 OP:NHOMOORG 189 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------1--------------1------------------------------------------------------------------------------------------------------------------4444444442444444314423444-1213-489A8961--111111111111111112173-1351-8-477--672-3-121221122525322555645645442333333333333223---3224-2-28111111111--6-----1-------1--11--------222---2------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------24----------------------------------------1412-31---1-1-111----11--111-1------15764411-----------------1---------3----------------------------------------111----------------------------------------11141111111-11-----------------1------111-1-------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 83 STR:RPRED 14.7 SQ:SECSTR ##############################################################################################################################################################################################################################################################################################################################################################################################################################################################################EEEEEccccHHHHHHHHHHHHHHTTccc#EEEEEEcHHHHHHHGGGccEEEEETTTGGGTTTcccEEccTcHHHHHHHHHHHHc################# DISOP:02AL 1-1,416-436,447-458| PSIPRED ccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHcccHHHccHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHcccccccccccHHHEEEEEEcccccHHHHHHHHHHHHHHccccEEEEEEcHHHHHHHHccccEEEEccHHHHcHHHHHHHHHHHccEEEEEcHHHHccccccHHHHHHHHHHHcc //