Streptococcus pneumoniae G54 (spne4)
Gene : ACF56347.1
DDBJ      :             IS1380-Spn1, transposase

Homologs  Archaea  0/68 : Bacteria  51/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:448 amino acids
:RPS:SCOP  286->414 1mm8A  c.55.3.4 * 3e-08 13.2 %
:HMM:SCOP  100->371 1musA_ c.55.3.4 * 1.7e-08 25.5 %
:HMM:PFM   143->366 PF01609 * Transposase_11 3.3e-24 21.1 199/207  
:HMM:PFM   329->428 PF05218 * DUF713 0.0001 17.7 96/182  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56347.1 GT:GENE ACF56347.1 GT:PRODUCT IS1380-Spn1, transposase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 884814..886160 GB:FROM 884814 GB:TO 886160 GB:DIRECTION + GB:PRODUCT IS1380-Spn1, transposase GB:NOTE identified by match to protein family HMM PF01609 GB:PROTEIN_ID ACF56347.1 GB:DB_XREF GI:194357899 LENGTH 448 SQ:AASEQ MNSLPNHHFQNKSFYQLSFDGGHLTQYGGLIFFQELFSQLKLKERISKYLVTNDQRRYCRYSDSDILVQFLFQLLTGYGTDYACKELSADAYFPKLLEGGQLASQPTLSRFLSRTDKETVHSLRCLNLELVEFFLQFHQLNQLIVDIDSTHFTTYGKQEGVAYNAHYRAHGYHPLYAFEGKTGYCFNAQLRPGNRYCSEEADSFITPVLERFNQLLFRMDSGFATPKLYDLIEKTGQCYLIKLKKNTVLSRLGDLSLPCPQDEDLTILPHSAYSETLYQAGSWSHKRRVCQFSERKEGNLFYDVISLVTNMTSGTSQDQFQLYRGRGQAENFIKEMKEGFFGDKTDSSTLIKNEVRMMMSCIAYNLYLFLKHLAGGDFQTLTIKRFRHLFLHVVGKCVRTGRKQLLKLSSLYAYSELFSALYSRIRKVNLNLPVPYEPPRRKASLMMH GT:EXON 1|1-448:0| HM:PFM:NREP 2 HM:PFM:REP 143->366|PF01609|3.3e-24|21.1|199/207|Transposase_11| HM:PFM:REP 329->428|PF05218|0.0001|17.7|96/182|DUF713| RP:SCP:NREP 1 RP:SCP:REP 286->414|1mm8A|3e-08|13.2|129/455|c.55.3.4| HM:SCP:REP 100->371|1musA_|1.7e-08|25.5|267/0|c.55.3.4|1/1|Ribonuclease H-like| OP:NHOMO 731 OP:NHOMOORG 51 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------1----------------------------------------------------------------------------5A--1------------111---E---------------------------------------------------------1-------9----------------------------------------------------------------------C1-5A211F26--------------11-----1--------------------------------D----N------13----------------------2-----------------1------1F-1---------8------6-------1----1*y******3---------------------------------------------------------------------------------------1---------------------------1----------------------------5------------------------4------6--------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6,442-444,446-449| PSIPRED ccccHHHcccccccEEEEEEcccccccHHHHHHHHHHHHHcHHHHHHHccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHcccHHHHHHccccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccEEEEEcccccccccccccccccccccccccccEEEEEEcccccEEEEEEcccccccHHHHHHHHHHHHHHHHHHEEEEEcccccHHHHHHHHHcccEEEEEccccHHHHHHHHHcccccccccccccccEEEEEEEEEEEcccccEEEEEEEEccccccccEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHcccHHHHHHEEEccEEEEEEEEEEEEEcccccccHHHHHHHHHHHHHHcccccccccccccccccccc //