[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56355.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:Y1535_STRPN  RecName: Full=UPF0213 protein SP_1535;

Homologs  Archaea  8/68 : Bacteria  261/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.226.1
:113 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->81 1zg2A PDBj 4e-21 57.0 %
:RPS:SCOP  4->84 1ln0A  d.226.1.1 * 6e-12 11.1 %
:HMM:SCOP  3->75 1mk0A_ d.226.1.1 * 1.6e-12 32.9 %
:RPS:PFM   7->74 PF01541 * GIY-YIG 8e-06 36.8 %
:HMM:PFM   5->76 PF01541 * GIY-YIG 7.9e-16 31.9 72/80  
:BLT:SWISS 1->82 Y1535_STRPN 1e-43 98.8 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56355.1 GT:GENE ACF56355.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1410917..1411258) GB:FROM 1410917 GB:TO 1411258 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE identified by match to protein family HMM PF01541 GB:PROTEIN_ID ACF56355.1 GB:DB_XREF GI:194357907 LENGTH 113 SQ:AASEQ MDHKAYMYVLECRDGSYYIGYTTDVRRRLAIHNSGKGAKYTRARLPVKLIYAQGFASKEEAMSAEALLKRKKRPQKEEFLSEIKIEIYSVILXNLGESFDSSYLCQKAKKMLQ GT:EXON 1|1-113:0| SW:ID Y1535_STRPN SW:DE RecName: Full=UPF0213 protein SP_1535; SW:GN OrderedLocusNames=SP_1535; SW:KW Complete proteome. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->82|Y1535_STRPN|1e-43|98.8|82/99| BL:PDB:NREP 1 BL:PDB:REP 1->81|1zg2A|4e-21|57.0|79/94| RP:PFM:NREP 1 RP:PFM:REP 7->74|PF01541|8e-06|36.8|68/80|GIY-YIG| HM:PFM:NREP 1 HM:PFM:REP 5->76|PF01541|7.9e-16|31.9|72/80|GIY-YIG| GO:PFM:NREP 3 GO:PFM GO:0004518|"GO:nuclease activity"|PF01541|IPR000305| GO:PFM GO:0005622|"GO:intracellular"|PF01541|IPR000305| GO:PFM GO:0006281|"GO:DNA repair"|PF01541|IPR000305| RP:SCP:NREP 1 RP:SCP:REP 4->84|1ln0A|6e-12|11.1|81/92|d.226.1.1| HM:SCP:REP 3->75|1mk0A_|1.6e-12|32.9|73/97|d.226.1.1|1/1|GIY-YIG endonuclease| OP:NHOMO 270 OP:NHOMOORG 269 OP:PATTERN ------------------------11111111------------------------------------ --------------------------------------------------------------------------------11-------------------1------1-------------------------------------1----------------1-----------------------------111111-111-11111111111111---11111111111--111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111-11-111111111111-111111---11--1--1111-111-----------------------11---1-1-11------------1----11---1--------------------------------------------------------------------------1--2------11111111111111111-111111111111--------------11---111-------------1--1-1-1-111----11111-1-1-11---1---------------------1---1-------111---11111-111111--111-1-------------------------------------------------------1-------------------------------------------1-----11-1--1------------------------------------1-------1----------1--------------1111111111-------------------------------------------------------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 84 STR:RPRED 74.3 SQ:SECSTR ccE##EEEEEEcTTccEEEEEEccHHHHHHHHHHHTTccccccccccEEEEEEEEccHHHHHHHHHHHHHccHHHHHHHHHHHHHc########################### DISOP:02AL 1-1,113-114| PSIPRED cccEEEEEEEEcccccEEEEEEccHHHHHHHHHcccccccccccccEEEEEEEEcccHHHHHHHHHHHHcccHHHHHHHHHHccHHHHHHHHHHHHHHcccHHHHHHHHHHcc //