[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56364.1
DDBJ      :             foldase protein PrsA
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:41 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   5->28 PF04703 * FaeA 0.00039 33.3 24/62  
:BLT:SWISS 1->40 PRSA_STRZT 5e-18 95.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56364.1 GT:GENE ACF56364.1 GT:PRODUCT foldase protein PrsA GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 874044..874169 GB:FROM 874044 GB:TO 874169 GB:DIRECTION + GB:PRODUCT foldase protein PrsA GB:NOTE contains potential frameshift GB:PROTEIN_ID ACF56364.1 GB:DB_XREF GI:194357916 LENGTH 41 SQ:AASEQ MDGVSDVMTATGTQAYSSQYYIVKLTKKTEKSSNIDDYKEN GT:EXON 1|1-41:0| BL:SWS:NREP 1 BL:SWS:REP 1->40|PRSA_STRZT|5e-18|95.0|40/313| HM:PFM:NREP 1 HM:PFM:REP 5->28|PF04703|0.00039|33.3|24/62|FaeA| OP:NHOMO 11 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,29-42| PSIPRED cccHHHHHHHccccccccEEEEEEEEccccccccccHHHcc //