[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56365.1
DDBJ      :             cytidine and deoxycytidylate deaminase family protein
Swiss-Prot:             

Homologs  Archaea  19/68 : Bacteria  285/915 : Eukaryota  155/199 : Viruses  8/175   --->[See Alignment]
c.97.1
:155 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->136 2hvwB PDBj 3e-38 52.3 %
:RPS:PDB   8->120 3b8fC PDBj 2e-23 12.0 %
:RPS:SCOP  9->151 1vq2A  c.97.1.2 * 5e-26 35.0 %
:HMM:SCOP  9->141 1vq2A_ c.97.1.2 * 1.3e-31 42.1 %
:RPS:PFM   9->116 PF00383 * dCMP_cyt_deam_1 3e-14 47.3 %
:HMM:PFM   7->117 PF00383 * dCMP_cyt_deam_1 3.9e-28 45.8 96/102  
:BLT:SWISS 4->153 COMEB_BACSU 1e-39 46.0 %
:PROS 72->106|PS00903|CYT_DCMP_DEAMINASES

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56365.1 GT:GENE ACF56365.1 GT:PRODUCT cytidine and deoxycytidylate deaminase family protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 660194..660661 GB:FROM 660194 GB:TO 660661 GB:DIRECTION + GB:PRODUCT cytidine and deoxycytidylate deaminase family protein GB:NOTE identified by match to protein family HMM PF00383 GB:PROTEIN_ID ACF56365.1 GB:DB_XREF GI:194357917 LENGTH 155 SQ:AASEQ MTEKRLAWDEYFAAQALLIANRSTCKRAKVGAILVKDNKVISTGYNGSVSGTEHCIDHECLVIEGHCVRTLHAEVNAILQGAERGVPKGFTAYVTHFPCLNCTKQLLQVGCKRVVYINQYRMDDYAQYLYQEKGTELTHLPLETVQTALKEADLM GT:EXON 1|1-155:0| BL:SWS:NREP 1 BL:SWS:REP 4->153|COMEB_BACSU|1e-39|46.0|150/189| PROS 72->106|PS00903|CYT_DCMP_DEAMINASES|PDOC00702| BL:PDB:NREP 1 BL:PDB:REP 5->136|2hvwB|3e-38|52.3|132/146| RP:PDB:NREP 1 RP:PDB:REP 8->120|3b8fC|2e-23|12.0|108/140| RP:PFM:NREP 1 RP:PFM:REP 9->116|PF00383|3e-14|47.3|93/100|dCMP_cyt_deam_1| HM:PFM:NREP 1 HM:PFM:REP 7->117|PF00383|3.9e-28|45.8|96/102|dCMP_cyt_deam_1| GO:PFM:NREP 2 GO:PFM GO:0008270|"GO:zinc ion binding"|PF00383|IPR002125| GO:PFM GO:0016787|"GO:hydrolase activity"|PF00383|IPR002125| RP:SCP:NREP 1 RP:SCP:REP 9->151|1vq2A|5e-26|35.0|143/173|c.97.1.2| HM:SCP:REP 9->141|1vq2A_|1.3e-31|42.1|133/0|c.97.1.2|1/1|Cytidine deaminase-like| OP:NHOMO 500 OP:NHOMOORG 467 OP:PATTERN -----------------------1----------------------1-11211-1111111111--11 ---------------------------------------------------------------1---------------1111-----1111-1111--111111-11-1---------------11111111111-----111---11-1-1-----------------1------------1-1----111111111111111111111111111111111--111111-1111111111111111111111111-11111111111111111-111111111111111111111111111111111111111111111111111-----------1211-111--11111111111111-1111111-11-----------------------------------------------------------------------------------------1----------------------------------------------------------------------------2--------------------------------1111111111111-111111111111111121-------------------1----------------------111----1-11-11------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111111----------------1---------------111----1--11-11----11--11---1111111111-1- --11--1-----11111111-11-11111-111-11-211--111111111111---1111111111111111111111111111111-1211-11111111-11--1--112111-11-11112211-342-122111-21111-1-1-1--1-11111211121-211---111---91111111121111111111 -------------------1---------------1-1-1--------------------------------------------------1-----1-----------------1---------------------------------------------------------1-- STR:NPRED 152 STR:RPRED 98.1 SQ:SECSTR cccccHHHHHHHHHHHHHHHHHHcccccEEEEEEEETTccEEEEcccccccGGGcccTTHHHHHHHHHHHTccEEEEEEEHHHHEEccTTcccEEccccHHHHHHHGGGcTTcEEEcccTTccccEEEHHHHTTcEEEEccHHHHHHHHHHH### DISOP:02AL 1-3| PSIPRED ccccHHHHHHHHHHHHHHHHHHcccccccEEEEEEEccEEEEEEccccccccccccccHHccccccccccccHHHHHHHHHHHcccccccEEEEEcccHHHHHHHHHHccccEEEEEccccccHHHHHHHHHcccEEEEEcHHHHHHHHcccccc //