[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56368.1
DDBJ      :             PTS system, IIBCA components
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  400/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
b.84.3d.95.1
:627 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->41 1o2fB PDBj 9e-05 43.2 %
:BLT:PDB   479->616 1gprA PDBj 5e-27 41.3 %
:RPS:PDB   4->78 3bp3A PDBj 1e-15 32.9 %
:RPS:PDB   477->626 1ax3A PDBj 6e-21 36.7 %
:RPS:SCOP  6->78 3bp8C1  d.95.1.1 * 3e-16 33.8 %
:RPS:SCOP  480->626 1f3gA  b.84.3.1 * 3e-36 32.0 %
:HMM:SCOP  5->82 1o2fB_ d.95.1.1 * 2.8e-19 48.7 %
:HMM:SCOP  472->626 2gprA_ b.84.3.1 * 3.8e-53 46.8 %
:RPS:PFM   7->41 PF00367 * PTS_EIIB 1e-10 60.0 %
:RPS:PFM   110->298 PF02378 * PTS_EIIC 7e-05 29.3 %
:RPS:PFM   479->607 PF00358 * PTS_EIIA_1 9e-33 51.9 %
:HMM:PFM   477->607 PF00358 * PTS_EIIA_1 4.7e-53 51.9 131/133  
:HMM:PFM   109->391 PF02378 * PTS_EIIC 9.5e-37 22.6 279/321  
:HMM:PFM   7->41 PF00367 * PTS_EIIB 1.1e-18 54.3 35/35  
:BLT:SWISS 1->626 PTS3B_STRMU e-101 42.5 %
:PROS 543->555|PS00371|PTS_EIIA_TYPE_1_HIS
:PROS 19->36|PS01035|PTS_EIIB_TYPE_1_CYS
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56368.1 GT:GENE ACF56368.1 GT:PRODUCT PTS system, IIBCA components GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1573513..1575396) GB:FROM 1573513 GB:TO 1575396 GB:DIRECTION - GB:PRODUCT PTS system, IIBCA components GB:NOTE identified by match to protein family HMM PF00358; match to protein family HMM PF00367; match to protein family HMM PF02378; match to protein family HMM TIGR00826; match to protein family HMM TIGR00830; match to protein family HMM TIGR01996 GB:PROTEIN_ID ACF56368.1 GB:DB_XREF GI:194357920 LENGTH 627 SQ:AASEQ MNNQEIAKKVIDALGGRENVNSVAHCATRLRVMVKDEEKINKEVIENLEKVQGAFFNSGQYQIIFGTGTVNKMYDEVVVLGLPTSSKDDMKAEVAKQGNWFQRAIRTFGDVFVPIIPVIVATGLFMGVRGLFNALEMPLPGDFATYTQILTDTAFIILPGLVVWSTFRVFGGNPAVGIVLGMMLVSGSLPNAWAVAQGGEVTAMNFFGFIPXVGLQGSVLPAFIIGVVGAKFEKAVRKVVPDVIDLLVTPFVTLLVMSILGLFVIGPVFHVVENYILIATKAILSMPFGLGGFLIGGVHQLIVVSGVHHIFNLLEVQLLAADHANPFNAIITAAMTAQGAATVAVGVKTKNPKLKTLAFPAALSAFLGITEPAIFGVNLRFRKPFFLSLIAGAIGGGLASILGLAGTGNGITIIPGTMLYVGNGQLPQYLLMVAVSFALGFALTYMFGYEDEVDATAAAKQAEVAEEKEEVAPAALQNETLVTPIVGDVVALADVNDPVFSSGAMGQGIAVKPSQGVVYAPADAEVSIAFPTGHAFGLKTRNGAEVLIHVGIDTVSMNGDGFEAKVAQGDKVKVGDVLGTFDSNKIATAGLDDTTMVIVTNTADYASVAPVATGSVAKGDAVIEVKI GT:EXON 1|1-627:0| BL:SWS:NREP 1 BL:SWS:REP 1->626|PTS3B_STRMU|e-101|42.5|624/664| PROS 543->555|PS00371|PTS_EIIA_TYPE_1_HIS|PDOC00528| PROS 19->36|PS01035|PTS_EIIB_TYPE_1_CYS|PDOC00795| TM:NTM 10 TM:REGION 108->130| TM:REGION 147->169| TM:REGION 172->194| TM:REGION 205->227| TM:REGION 242->264| TM:REGION 288->310| TM:REGION 356->378| TM:REGION 392->414| TM:REGION 427->449| TM:REGION 477->499| SEG 329->347|aiitaamtaqgaatvavgv| SEG 387->417|lsliagaiggglasilglagtgngitiipgt| SEG 452->475|evdataaakqaevaeekeevapaa| BL:PDB:NREP 2 BL:PDB:REP 5->41|1o2fB|9e-05|43.2|37/77| BL:PDB:REP 479->616|1gprA|5e-27|41.3|138/158| RP:PDB:NREP 2 RP:PDB:REP 4->78|3bp3A|1e-15|32.9|73/79| RP:PDB:REP 477->626|1ax3A|6e-21|36.7|150/162| RP:PFM:NREP 3 RP:PFM:REP 7->41|PF00367|1e-10|60.0|35/35|PTS_EIIB| RP:PFM:REP 110->298|PF02378|7e-05|29.3|184/313|PTS_EIIC| RP:PFM:REP 479->607|PF00358|9e-33|51.9|129/132|PTS_EIIA_1| HM:PFM:NREP 3 HM:PFM:REP 477->607|PF00358|4.7e-53|51.9|131/133|PTS_EIIA_1| HM:PFM:REP 109->391|PF02378|9.5e-37|22.6|279/321|PTS_EIIC| HM:PFM:REP 7->41|PF00367|1.1e-18|54.3|35/35|PTS_EIIB| GO:PFM:NREP 8 GO:PFM GO:0005351|"GO:sugar:hydrogen symporter activity"|PF02378|IPR003352| GO:PFM GO:0008982|"GO:protein-N(PI)-phosphohistidine-sugar phosphotransferase activity"|PF02378|IPR003352| GO:PFM GO:0009401|"GO:phosphoenolpyruvate-dependent sugar phosphotransferase system"|PF02378|IPR003352| GO:PFM GO:0016020|"GO:membrane"|PF02378|IPR003352| GO:PFM GO:0005351|"GO:sugar:hydrogen symporter activity"|PF00358|IPR001127| GO:PFM GO:0006810|"GO:transport"|PF00358|IPR001127| GO:PFM GO:0009401|"GO:phosphoenolpyruvate-dependent sugar phosphotransferase system"|PF00358|IPR001127| GO:PFM GO:0016020|"GO:membrane"|PF00358|IPR001127| RP:SCP:NREP 2 RP:SCP:REP 6->78|3bp8C1|3e-16|33.8|71/75|d.95.1.1| RP:SCP:REP 480->626|1f3gA|3e-36|32.0|147/150|b.84.3.1| HM:SCP:REP 5->82|1o2fB_|2.8e-19|48.7|76/0|d.95.1.1|1/1|Glucose permease domain IIB| HM:SCP:REP 472->626|2gprA_|3.8e-53|46.8|154/0|b.84.3.1|1/1|Duplicated hybrid motif| OP:NHOMO 1519 OP:NHOMOORG 402 OP:PATTERN -------------------------------------------------------------------- ----131122415------------1-----------111-------11-1--12--------4-1111111---2114---1-----------------------------------------------------------------------------------------------------1-----2-46555555454554545779999654444136836673812577777778777777633569A-47612659II227942846453455555444444444444443444444444444444554535554---6GAAABA9B596-E11233311-3-212-----1---1--311--15---122---------------------------------2-----------------------------------------------------------------------------------1--------111111111111111111111111--1-----2------------------3----------------------------------------------------------------------1--435-----1-31111111111111111111-------11-11167742946555667666-5666665666565666666787997554444444444443444754455552-833333333333--1---------------222534111112114------------11111313-------------------22224444423233-----------------5------11111111-------B---21211111344111---------------- -------------1-----------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 224 STR:RPRED 35.7 SQ:SECSTR ###cccHHHHHHHTTcGGGEEEEEEcccEEEEEEccGGGccHHHHHHTTccEEEEETTE#EEEEcGGGTHHHHHHHHH##############################################################################################################################################################################################################################################################################################################################################################################################################ccccccccccEEEEEGGGcccHHHHTcTTcEEEEEEEcccEEEEcccEEEEEccccccEEEEEcccccEEEEEccccTTTTTTTTEEEccccccEEccEEEEEEEcHHHHGGGcccccEEEEEccGGGTcEEEEccccEcTTccccEEEE# DISOP:02AL 1-1,77-101,452-478| PSIPRED ccHHHHHHHHHHHcccHHHHHHHHHcccEEEEEEEcHHHccHHHHHcccccEEEEEEccEEEEEEccccHHHHHHHHHHHcccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcHHHccHHHHHcccccccEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccHHHHEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccEEEEcccccEEEEHHHcccHHHccccccccEEEEEcccEEEEEEccEEEEEEccccEEEEEEccccEEEEEEccccccccccccEEEEccccEEEcccEEEEEcHHHHHHcccccEEEEEEccHHHHHcEEEccccccccccEEEEEEc //