[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56369.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  37/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:74 amino acids
:PSIPRED
:HMM:PFM   13->61 PF07672 * MFS_Mycoplasma 0.00024 30.6 49/267  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56369.1 GT:GENE ACF56369.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1344367..1344591) GB:FROM 1344367 GB:TO 1344591 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF56369.1 GB:DB_XREF GI:194357921 LENGTH 74 SQ:AASEQ MLLQLFSLYFESLILTTILVLIFLGIWIGLRAMSGVDKTARARQAHLYDMIMIGVLVVPVLSFAVMSLILVFKA GT:EXON 1|1-74:0| TM:NTM 2 TM:REGION 9->31| TM:REGION 49->71| SEG 13->26|lilttilvliflgi| HM:PFM:NREP 1 HM:PFM:REP 13->61|PF07672|0.00024|30.6|49/267|MFS_Mycoplasma| OP:NHOMO 37 OP:NHOMOORG 37 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111111111111111111111111111----1---1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //