[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56377.1
DDBJ      :             cytidine deaminase
Swiss-Prot:             

Homologs  Archaea  21/68 : Bacteria  389/915 : Eukaryota  144/199 : Viruses  0/175   --->[See Alignment]
c.97.1
:129 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->122 2d30A PDBj 5e-37 56.6 %
:RPS:PDB   1->125 3dmoB PDBj 9e-29 47.2 %
:RPS:SCOP  5->125 1wn5A1  c.97.1.1 * 1e-36 23.9 %
:HMM:SCOP  1->124 2d30A1 c.97.1.1 * 5.7e-44 47.6 %
:RPS:PFM   7->94 PF00383 * dCMP_cyt_deam_1 9e-09 38.6 %
:HMM:PFM   4->96 PF00383 * dCMP_cyt_deam_1 8.1e-21 35.2 88/102  
:BLT:SWISS 6->129 CDD_BACHD 6e-33 55.6 %
:PROS 53->93|PS00903|CYT_DCMP_DEAMINASES

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56377.1 GT:GENE ACF56377.1 GT:PRODUCT cytidine deaminase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 740970..741359 GB:FROM 740970 GB:TO 741359 GB:DIRECTION + GB:PRODUCT cytidine deaminase GB:NOTE identified by match to protein family HMM PF00383; match to protein family HMM TIGR01354 GB:PROTEIN_ID ACF56377.1 GB:DB_XREF GI:194357929 LENGTH 129 SQ:AASEQ MATTELIELAIETSKHAYVPYSHFPIGAVLVAKDGSVYTGVNIENASYPLTNCGERTAIFKAISEGQREFSELIVYGQTEKPISPCGACRQVMVEFFEQDLKVTLVAKDKSTVEMTVGELLPYSFTDLN GT:EXON 1|1-129:0| BL:SWS:NREP 1 BL:SWS:REP 6->129|CDD_BACHD|6e-33|55.6|124/132| PROS 53->93|PS00903|CYT_DCMP_DEAMINASES|PDOC00702| BL:PDB:NREP 1 BL:PDB:REP 1->122|2d30A|5e-37|56.6|122/124| RP:PDB:NREP 1 RP:PDB:REP 1->125|3dmoB|9e-29|47.2|125/127| RP:PFM:NREP 1 RP:PFM:REP 7->94|PF00383|9e-09|38.6|83/100|dCMP_cyt_deam_1| HM:PFM:NREP 1 HM:PFM:REP 4->96|PF00383|8.1e-21|35.2|88/102|dCMP_cyt_deam_1| GO:PFM:NREP 2 GO:PFM GO:0008270|"GO:zinc ion binding"|PF00383|IPR002125| GO:PFM GO:0016787|"GO:hydrolase activity"|PF00383|IPR002125| RP:SCP:NREP 1 RP:SCP:REP 5->125|1wn5A1|1e-36|23.9|117/125|c.97.1.1| HM:SCP:REP 1->124|2d30A1|5.7e-44|47.6|124/0|c.97.1.1|1/1|Cytidine deaminase-like| OP:NHOMO 617 OP:NHOMOORG 554 OP:PATTERN 111-111----------111111-11111111----------------1------------------- 1-1-11------1-11111-31111111111111111111---11-111111111111--1111-11111--------1---1-----1111-111---1111111--1-------------------------1-11111---1---1---1----1-1----2------------------1111111-111333322331333223111111232111111211111111111111111111111111111-11111--1-----11---11111111111111111221112111211111111111111111111111111221111111111111111111121111111111111111111111-11-1111------11-1-----------------------1--11111--111111111111-1-1-1111111111---------11---1-------------------------------1-111------1111-11-11--1-1111-11-1---------------------------1--------------1-----11--------1-----1-----11-------------------------------11--1-1-1---------------1-----------------------------------------------------------------------------1------------------------------1111---11--------------------------------------------111111111------------1--------------------------11-111111-1----1-11-11111111-11111111111111111-1- ----11--211111-1111-11111--111-111111111-111-111111111111111111-11111111-11111111-11--11-122111211-1-11111-1-1113332-1-1-11111111121-111-11-1111--111111-11111-22114121311222111-------------1--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 129 STR:RPRED 100.0 SQ:SECSTR ccHHHHHHHHHHHHTTcccTTTccccEEEEEETTccEEEEEccccccGGGcccHHHHHHHHHHHTTccTTEEEEEEEcccccccccHHHHHHHHHHHcTTcEEEEEETTccEEEEEHHHHcTTcccTcc DISOP:02AL 1-1,127-130| PSIPRED ccHHHHHHHHHHHHHHcccccccccEEEEEEEccccEEEEEEEEcccccccHHHHHHHHHHHHHcccccEEEEEEEccccccccccHHHHHHHHHHcccccEEEEEcccccEEEEEHHHHccccccccc //