[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56378.1
DDBJ      :             ABC transporter, ATP-binding protein
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  909/915 : Eukaryota  197/199 : Viruses  1/175   --->[See Alignment]
c.37.1
:210 amino acids
:PSIPRED
:BLT:PDB   1->193 1l2tB PDBj 4e-30 36.8 %
:RPS:PDB   2->208 3b5jA PDBj 4e-35 22.4 %
:RPS:SCOP  1->208 1b0uA  c.37.1.12 * 8e-38 28.8 %
:HMM:SCOP  4->208 1ii8.1 c.37.1.12 * 9.5e-58 33.3 %
:RPS:PFM   41->163 PF00005 * ABC_tran 7e-13 35.6 %
:RPS:PFM   135->204 PF02463 * SMC_N 9e-05 39.1 %
:HMM:PFM   41->163 PF00005 * ABC_tran 6.2e-25 38.8 116/118  
:HMM:PFM   8->48 PF03193 * DUF258 1.7e-06 30.0 40/161  
:BLT:SWISS 1->203 MACB_CAMJR 3e-33 37.1 %
:PROS 149->155|PS00092|N6_MTASE
:PROS 135->149|PS00211|ABC_TRANSPORTER_1

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56378.1 GT:GENE ACF56378.1 GT:PRODUCT ABC transporter, ATP-binding protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 1770903..1771535 GB:FROM 1770903 GB:TO 1771535 GB:DIRECTION + GB:PRODUCT ABC transporter, ATP-binding protein GB:NOTE identified by match to protein family HMM PF00005; match to protein family HMM TIGR03608 GB:PROTEIN_ID ACF56378.1 GB:DB_XREF GI:194357930 LENGTH 210 SQ:AASEQ MIELKQVSKSFGERELFSNLSMTFEAGKVYALIGSSGSGKTTLMNMIGKLEPYDGTIFYRGKDLANYKSSDFFRHELGYLFQNFGLIENQSIEENLKLGLIGQKLSRSEQRLRQKQALEQVGLAYLDLDKRIFELSGGESQRVALAKIILKNPPFILADEPTASIDPATSQLIMEILLSLRDDNRLIIIATHNPAIWEMADEVFTMDHLK GT:EXON 1|1-210:0| BL:SWS:NREP 1 BL:SWS:REP 1->203|MACB_CAMJR|3e-33|37.1|202/641| PROS 149->155|PS00092|N6_MTASE|PDOC00087| PROS 135->149|PS00211|ABC_TRANSPORTER_1|PDOC00185| BL:PDB:NREP 1 BL:PDB:REP 1->193|1l2tB|4e-30|36.8|193/232| RP:PDB:NREP 1 RP:PDB:REP 2->208|3b5jA|4e-35|22.4|205/243| RP:PFM:NREP 2 RP:PFM:REP 41->163|PF00005|7e-13|35.6|118/123|ABC_tran| RP:PFM:REP 135->204|PF02463|9e-05|39.1|69/536|SMC_N| HM:PFM:NREP 2 HM:PFM:REP 41->163|PF00005|6.2e-25|38.8|116/118|ABC_tran| HM:PFM:REP 8->48|PF03193|1.7e-06|30.0|40/161|DUF258| GO:PFM:NREP 4 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| GO:PFM GO:0005524|"GO:ATP binding"|PF02463|IPR003395| GO:PFM GO:0005694|"GO:chromosome"|PF02463|IPR003395| RP:SCP:NREP 1 RP:SCP:REP 1->208|1b0uA|8e-38|28.8|208/258|c.37.1.12| HM:SCP:REP 4->208|1ii8.1|9.5e-58|33.3|204/370|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 51066 OP:NHOMOORG 1175 OP:PATTERN RQLATLIGQQQMSMVPjINNJNNZuLPdlThTKEEDECIHIFCTWSUjNR**f8ObLUWMQJJCX18A UboK*gedqqtXYTVPRNM-MjAAW*NNNNNOupnrt***S*O*o*pYrieP**zNRiBCqv*j*mw***eeZYY*cafP*hiBCDBDYXZT6TILL-1KIZNOOiSeOa99999999BCAAAAKUQOWcSOXVcVlrrz*PON*XuhpugfpaeTUOKNJMJehbn***cJSJNKKLQHNJJdYbPNphBVg*************************hq***rt***zy***dlmonollmnlllmmdkdhh*mch**gSham**QR**ZXSbomllnvvz*yt**zzx*xxusy*vxweeedcehgiffdd*usihivuxqu***********l*ot***glni**j***otVK**uqYejpTZnhqqPfZXNgUUULMONMRiX***eWy****************-ov*ki*o***SF**************KMM**********VUVVVVVVzbfLRlY*76577666668AC8EF8CED9AAAB97A6LFEFEH************yy*u********l********DS**x*mupv******ZrqObOVraLNKKMKKVRPeuqh**UlW*oVhvebmLjfdUWYhWcXbWZq*a*RMOUIRPQRPJAEDCDEECDHYHHNONtt*UzagNWN*XYbcZRZjYXWabZgccff5-EKQSO321444****Z************-*************z**********stmpsnpqqrprpnoropo*ystzzz*X4************43KKEHEEFMPRORO*r*cdcdcaLRUPNWTXkOQSQQHVJQVvh**zy*********j***HHHGHHHGHOnus*vwwww*****TRPOPPOMOOCBBBA9QWUTMMLNAA988988*DYDABDF-DDDCEDCRQN8BNBGB889boxVVm*qpnGeO 2145liJ-WKC8MWLFAHE9HLGLAMEFFAB8AJGG9DBBECB999EDGJKGQLGEIAABCCA4C5662485BB9773777AA7AE35-DI8AE9E99B965AOIOBSajeWbTkdVHDEBGVLrjAwA**i2iPgHCD7eAJcV9MDEAZCB*EWQPsFc*KpPgA*be*XiVIFGFD*IFGKO*nu*E**HH*t*xO ------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------ PSIPRED cEEEEEEEEEEccEEEEEccEEEEccccEEEEEccccccHHHHHHHHHcccccccEEEEccEEcccccHHHHHHHHccEEEEEccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccHHHcccHHHccccHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEcccHHHHHHccEEEEEcccc //