[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56382.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:67 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   8->38 PF10439 * Bacteriocin_IIc 4.4e-06 35.5 31/65  
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56382.1 GT:GENE ACF56382.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 476879..477082 GB:FROM 476879 GB:TO 477082 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE identified by glimmer; putative GB:PROTEIN_ID ACF56382.1 GB:DB_XREF GI:194357934 LENGTH 67 SQ:AASEQ MEKIDYITLNEVELETISGGDDCFIGDIGCIGWGLLKSIGGMIKPAPYVPPVCIPKSSWNPAPPVPC GT:EXON 1|1-67:0| SEG 19->34|ggddcfigdigcigwg| HM:PFM:NREP 1 HM:PFM:REP 8->38|PF10439|4.4e-06|35.5|31/65|Bacteriocin_IIc| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,67-68| PSIPRED cccEEEEEEcEEEEEEEcccccEEEEcHHHHHHHHHHHHHHHcccccccccEEcccccccccccccc //