[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56390.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  42/68 : Bacteria  825/915 : Eukaryota  198/199 : Viruses  1/175   --->[See Alignment]
c.37.1
:360 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   15->332 1s2mA PDBj 6e-31 27.0 %
:RPS:PDB   4->326 1cu1A PDBj 2e-37 10.9 %
:RPS:PDB   299->338 3bxzA PDBj 3e-08 15.0 %
:RPS:SCOP  16->334 1pjrA1  c.37.1.19 * 7e-25 6.7 %
:HMM:SCOP  28->344 2bmfA2 c.37.1.14 * 4.2e-56 31.3 %
:RPS:PFM   22->179 PF00270 * DEAD 8e-21 33.5 %
:RPS:PFM   253->321 PF00271 * Helicase_C 6e-08 31.9 %
:HMM:PFM   22->187 PF00270 * DEAD 4.8e-42 35.8 165/167  
:HMM:PFM   247->323 PF00271 * Helicase_C 1.8e-22 36.4 77/78  
:BLT:SWISS 10->345 YFML_BACSU 2e-57 39.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56390.1 GT:GENE ACF56390.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 1364290..1365372 GB:FROM 1364290 GB:TO 1365372 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE identified by match to protein family HMM PF00270; match to protein family HMM PF00271 GB:PROTEIN_ID ACF56390.1 GB:DB_XREF GI:194357942 LENGTH 360 SQ:AASEQ MKTKLPTEWQELSDQLGFQEFTPIQTQLFELLLAGENLLGVSQTGTGKTLAYLLPSLLRLQKKKAQQLLILAPNTELAGQIFDVCKTWAEAIGLTAQLFLSGSSQKRQIERLKKGPEILIGTPGRIFELIKLKKIKMMNVETIILDEFDQLLDDSQIHFVEKITHYAPRDHQLVYMSATTKFDQEKIVPNTRTIDLSDQKLDNIQHFYMQVDQRHRVDMLRKLAHVEDFRGLVFFNSLSDLGNAEEKLQYRDILAVSLASDVNVKFRKIILEKFKDNQLTLLLATDLLARGIDIDSLECVVNFDIPRDSETYTHRAGRTGRMGKEGYVITLVTHPEEIKKLKKFASIREIVLKNQELYIK GT:EXON 1|1-360:0| BL:SWS:NREP 1 BL:SWS:REP 10->345|YFML_BACSU|2e-57|39.8|334/376| SEG 28->40|lfelllagenllg| SEG 57->71|llrlqkkkaqqllil| SEG 279->289|ltlllatdlla| BL:PDB:NREP 1 BL:PDB:REP 15->332|1s2mA|6e-31|27.0|318/377| RP:PDB:NREP 2 RP:PDB:REP 4->326|1cu1A|2e-37|10.9|293/645| RP:PDB:REP 299->338|3bxzA|3e-08|15.0|40/438| RP:PFM:NREP 2 RP:PFM:REP 22->179|PF00270|8e-21|33.5|158/167|DEAD| RP:PFM:REP 253->321|PF00271|6e-08|31.9|69/76|Helicase_C| HM:PFM:NREP 2 HM:PFM:REP 22->187|PF00270|4.8e-42|35.8|165/167|DEAD| HM:PFM:REP 247->323|PF00271|1.8e-22|36.4|77/78|Helicase_C| GO:PFM:NREP 6 GO:PFM GO:0003676|"GO:nucleic acid binding"|PF00270|IPR011545| GO:PFM GO:0005524|"GO:ATP binding"|PF00270|IPR011545| GO:PFM GO:0008026|"GO:ATP-dependent helicase activity"|PF00270|IPR011545| GO:PFM GO:0003676|"GO:nucleic acid binding"|PF00271|IPR001650| GO:PFM GO:0004386|"GO:helicase activity"|PF00271|IPR001650| GO:PFM GO:0005524|"GO:ATP binding"|PF00271|IPR001650| RP:SCP:NREP 1 RP:SCP:REP 16->334|1pjrA1|7e-25|6.7|297/315|c.37.1.19| HM:SCP:REP 28->344|2bmfA2|4.2e-56|31.3|278/0|c.37.1.14|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 8422 OP:NHOMOORG 1066 OP:PATTERN ---1--1111111121-1-----1--------1111111111111111-2112----1111111--11 1111333333332232322-23113322222233333555-32333432444333323--4432333564211111111131-11111444413221--51563268715--------------222122222212111111111121-1111----12122111-2222111111111111131111--1124555555554555555434444555222325444444454233333323333333222223333333333333333333333222233333333333333333323333333333333333333333333-523655555555553422433334-1-121113334-1111------113-3323322212233332223333333333333333-3333333323223333333333333323333233333314444444435553323------------111111111111111111233324444355555554444445544443455544442344453544555554553343353222222222244573725253214332-444534544332364424--1-------1111111115111522997646B6899ACCCCCCCCCCCBCCBCBB1-2222311111154555555555555555-55555555555555555555555544555555555555454455554555541544556644556114511111333325448323333233333333222222222256666666666666666663222222225AAAA999998BBAA44555555553333232-332222--------11322232---1--12---11-11-11111111------33 KHEHMMJ4oGFBKKQFIJIJKMKHIIHKKJKKLHGFHKGIFHGJJJIJGHGGIFHHIGIIIIIHIILHFLKKJKKLMINNKJIKKIHI-GOHIJHMKHHJLGGYYXANWNhbeWTVcPJJGNVMqhJwH**g3oavHMNGfHTYPIVPKNZGFpMZNPSRnmdWPPKdRc*UXWNDMOT*WXSJQneuwLuhLLRPPTM --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- STR:NPRED 359 STR:RPRED 99.7 SQ:SECSTR #TTEEEEEEEHHHHHHHHHcccccccccccccccccEEEEEccccccTTTHHHHHHHHHcHHTTTccEEEEEccHHHHHHHHHHHHHHGGGTTccEHHTccccEEEcccccccccccEEEEEHHHHHHHTcccTTcccEEEEETTTcccHHHHHHHHHHHHHTTTTTccEEEEEEcccTTccccccHHcEEEcccccccccTTEEEEEccccccEEETTEEEcGGGTccEEEEEccccHHHHHHHHHHHHTTccEEEEcTTcccccccccccEEEEEcTTHHHHccccccEEEEccEEEEEEEEcccEEEEEEEEccHHHHHHHHTEEEEEEcccTHHHHHHHHHHHTTcccEEcccHHH DISOP:02AL 1-2,359-361| PSIPRED ccccccHHHHHHHHHcccccccHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHccccccEEEEEcccHHHHHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHccccEEEEccHHHHHHHHccccccccEEEEEEEccHHHcccccHHHHHHHHHHcccHHcEEEEEccccHHHHHHcccEEEEEEccccccccEEEEEEEcHHHHHHHHHHHHHcccccEEEEEccHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHcccccEEEEccHHHcccccccccEEEEEcccccHHHHccccccccccccccEEEEEEccHHHHHHHHHHHHHHcccccccccccc //