[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56391.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  51/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:89 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   15->69 PF06961 * DUF1294 3e-11 58.2 %
:HMM:PFM   15->69 PF06961 * DUF1294 4.2e-25 43.6 55/55  
:HMM:PFM   55->85 PF09529 * Intg_mem_TP0381 0.00097 33.3 30/225  
:BLT:SWISS 7->70 YSDA_BACSU 6e-11 43.8 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56391.1 GT:GENE ACF56391.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1125491..1125760) GB:FROM 1125491 GB:TO 1125760 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE identified by match to protein family HMM PF06961 GB:PROTEIN_ID ACF56391.1 GB:DB_XREF GI:194357943 LENGTH 89 SQ:AASEQ MKLDEKITLVLLIWNVIIFLIYGIDKSKARRRVWRIPEKILLILAFTFGGFGAWLAGITFHHKTRKWYFKTVWFLGMVTTLVALYFIWR GT:EXON 1|1-89:0| BL:SWS:NREP 1 BL:SWS:REP 7->70|YSDA_BACSU|6e-11|43.8|64/100| TM:NTM 3 TM:REGION 4->26| TM:REGION 37->58| TM:REGION 69->89| RP:PFM:NREP 1 RP:PFM:REP 15->69|PF06961|3e-11|58.2|55/55|DUF1294| HM:PFM:NREP 2 HM:PFM:REP 15->69|PF06961|4.2e-25|43.6|55/55|DUF1294| HM:PFM:REP 55->85|PF09529|0.00097|33.3|30/225|Intg_mem_TP0381| OP:NHOMO 54 OP:NHOMOORG 54 OP:PATTERN --------------------------------------------1-----1-1--------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------11111-------------------------1--1----------------11-11111111--11-1111111111111111111--11----1111---------------1-------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------11----------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHc //