[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56400.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  16/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.134.1
:249 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->218 3dffA PDBj 1e-12 28.4 %
:RPS:PDB   3->110 3dfiA PDBj 8e-09 28.0 %
:RPS:SCOP  8->226 1uanA  c.134.1.1 * 4e-20 22.5 %
:HMM:SCOP  3->245 1q74A_ c.134.1.1 * 1.2e-23 20.7 %
:HMM:PFM   9->158 PF02585 * PIG-L 3.1e-19 28.5 123/128  
:BLT:SWISS 100->219 LRIQ3_RAT 2e-04 33.9 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56400.1 GT:GENE ACF56400.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 143809..144558 GB:FROM 143809 GB:TO 144558 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE identified by match to protein family HMM PF02585 GB:PROTEIN_ID ACF56400.1 GB:DB_XREF GI:194357952 LENGTH 249 SQ:AASEQ MSNNTKYIFLSPHLDDAIFSCGDYISKLTSEGEIVLVITIFSGYPLSQQLQSSAKQFHKLCNLGKYPIEERKKEDRLACERLQCDFRHLSYYECLYRKDRNGNFLYRHIYSELKNEDTLKNDIIKELLMHLDDKCVVYCPLSLGDHVDHVFVNSIGRALEFMRYKVIYYEDFPYVSDSSMVSYMGKTKELKIYQEELDKKHYIDRISSILCYKSQILIIWKSVEKLLNNIKELYLRNGAAYSIIFWIKK GT:EXON 1|1-249:0| BL:SWS:NREP 1 BL:SWS:REP 100->219|LRIQ3_RAT|2e-04|33.9|115/633| BL:PDB:NREP 1 BL:PDB:REP 5->218|3dffA|1e-12|28.4|211/263| RP:PDB:NREP 1 RP:PDB:REP 3->110|3dfiA|8e-09|28.0|107/242| HM:PFM:NREP 1 HM:PFM:REP 9->158|PF02585|3.1e-19|28.5|123/128|PIG-L| RP:SCP:NREP 1 RP:SCP:REP 8->226|1uanA|4e-20|22.5|182/220|c.134.1.1| HM:SCP:REP 3->245|1q74A_|1.2e-23|20.7|227/297|c.134.1.1|1/1|LmbE-like| OP:NHOMO 16 OP:NHOMOORG 16 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------1---1---1------------------------------------------------------------------------------------------------------------------------------------------------11111111111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 215 STR:RPRED 86.3 SQ:SECSTR ##cccEEEEEEccTTHHHHHHHHHHHHHHHTTcEEEEEEccccccccccccHHHHHHHHHHTccTTcHHHHHHHHHHHHHHHTcEEEEcccccGGGccHHHHHHHHHHHHTcccccccHHHHHHHHHHHHHcccEEEEE#ccTTccHHHHHHHHHHHHHHHHTccEEEEccTTGGGTccccccccTTEEEcccEEccccHHHHHHHHHHTTcGGGHHH############################### DISOP:02AL 1-2| PSIPRED cccccEEEEEEccccHHHHHHHHHHHHHHHccccEEEEEEcccccccccccccHHHHHHHcccccccHHHHHHHHHHHHHHccccEEEcccccccccccccccHHHHHccccccccccHHHHHHHHHHHHHccccEEEEcccccccHHHHHHHHHHHHHHHccccEEEEccccccccccccccccccccHHcccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccEEEEcc //