[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56401.1
DDBJ      :             ABC transporter, permease protein
Swiss-Prot:             

Homologs  Archaea  30/68 : Bacteria  694/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:226 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   25->139 3dhwA PDBj 3e-05 27.9 %
:RPS:PDB   112->153 3dhwA PDBj 2e-06 36.8 %
:RPS:SCOP  1->216 2r6gG1  f.58.1.1 * 2e-21 17.1 %
:HMM:PFM   33->213 PF00528 * BPD_transp_1 3.4e-16 21.5 177/185  
:HMM:PFM   9->41 PF01313 * Bac_export_3 0.00029 27.3 33/76  
:BLT:SWISS 1->211 GLNM_BACSU 8e-31 33.8 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56401.1 GT:GENE ACF56401.1 GT:PRODUCT ABC transporter, permease protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(631731..632411) GB:FROM 631731 GB:TO 632411 GB:DIRECTION - GB:PRODUCT ABC transporter, permease protein GB:NOTE identified by match to protein family HMM PF00528; match to protein family HMM TIGR01726 GB:PROTEIN_ID ACF56401.1 GB:DB_XREF GI:194357953 LENGTH 226 SQ:AASEQ MDWSIVEQYLPLYQKAFFLTLHIAVWGILGSFLLGLIVSIIRHYRIPVLAQVATAYIELSRNTPLLIQLFFLYFGLPRIGIVLSSEVCATLGLVFLGGSYMAESFRSGLEAISQTQQEIGLAIGLTPLQVFRYVVLPQATAVALPSFSANVIFLIKETSVFSAVALADLMYVAKDLIGLYYETDIALAMLVXAYLIMLLPISLVFSWIERRTRHAGFGNPSTLSRK GT:EXON 1|1-226:0| BL:SWS:NREP 1 BL:SWS:REP 1->211|GLNM_BACSU|8e-31|33.8|207/216| TM:NTM 6 TM:REGION 13->35| TM:REGION 48->70| TM:REGION 78->100| TM:REGION 120->142| TM:REGION 153->175| TM:REGION 186->208| BL:PDB:NREP 1 BL:PDB:REP 25->139|3dhwA|3e-05|27.9|111/203| RP:PDB:NREP 1 RP:PDB:REP 112->153|3dhwA|2e-06|36.8|38/203| HM:PFM:NREP 2 HM:PFM:REP 33->213|PF00528|3.4e-16|21.5|177/185|BPD_transp_1| HM:PFM:REP 9->41|PF01313|0.00029|27.3|33/76|Bac_export_3| RP:SCP:NREP 1 RP:SCP:REP 1->216|2r6gG1|2e-21|17.1|216/284|f.58.1.1| OP:NHOMO 4386 OP:NHOMOORG 728 OP:PATTERN 11--12----------1-1111114--11-2211----1122--2212--1-1----2------2--- ----43133333214------5---B------644435B814224283433-658134--222-577B4A4755576631421---------------------------11111111111111-----1--4---222341111-2234223332211111--1--3322-1212--1212-1341111--26455555875566556623398556333754355555396222222222222222222246657AB885676666B93757E43338888666599888777888876666566666666778BA98888135575645455232344423333122142331AA-4122-1111111171--11117344411K66111311112375347567P-22F22B28DJ23mSSOTWTVUgJMOA---13J545725A1111111133511-38----------111111111111111--1-5--21-5FDAHMLLKNJC9DDDFFITEDEEADHGc7794-2B9C94854B9HGMQ244----944422222---25--1I-896C56B99932-23-3----------4-3341665553343332333-12----9AB-3-----C-1111--11111111-11-1---1--------99JK7CC9999998998-99B9999999999899889GMELK7769796999999999979G887888832ECCCBCBBCBBB--5-222221111--69C55553533323333255555-54553-FDDFGPJSAFGBD5KIK----------677A888889997711---------------2----------------3212----------------------132-115111--1 --------------------------------------------------------------------------------------------------------------------------------------------------------------2----2------6-----------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 178 STR:RPRED 78.8 SQ:SECSTR ########################HHHHHH#HHTTGGGGGGGGGGTTcHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHTTccccHHHHHHHHHHHHHHHHHHHHHHHHccTTTTTHHHHHTccTHHHHHHTTHHHHHHHHHHHHHHHHHHHHTccHHHHHHcccGGGccH##HHHGccHHHHHHHHHHTH#####HHHHHHHHHHTT################ DISOP:02AL 214-227| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHcc //