[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56409.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  50/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.113.1
:87 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->80 2azwA PDBj 3e-24 53.2 %
:RPS:PDB   3->84 2azwA PDBj 2e-10 51.9 %
:RPS:SCOP  3->84 2azwA1  d.113.1.1 * 2e-10 51.9 %
:HMM:SCOP  3->85 2azwA1 d.113.1.1 * 2.1e-10 20.5 %
:HMM:PFM   22->83 PF04033 * DUF365 2.1e-06 19.7 61/97  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56409.1 GT:GENE ACF56409.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(720858..721121) GB:FROM 720858 GB:TO 721121 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE contains potential frameshift GB:PROTEIN_ID ACF56409.1 GB:DB_XREF GI:194357961 LENGTH 87 SQ:AASEQ MIEELGFTAEIGTYYGQADEYFYSRHRDTYYYNPAYLYEATSFKEVQKPLENFNHIAWFPIDEAIQNLKRGSHKWAIESWKKQHKIG GT:EXON 1|1-87:0| BL:PDB:NREP 1 BL:PDB:REP 1->80|2azwA|3e-24|53.2|79/146| RP:PDB:NREP 1 RP:PDB:REP 3->84|2azwA|2e-10|51.9|81/146| HM:PFM:NREP 1 HM:PFM:REP 22->83|PF04033|2.1e-06|19.7|61/97|DUF365| RP:SCP:NREP 1 RP:SCP:REP 3->84|2azwA1|2e-10|51.9|81/146|d.113.1.1| HM:SCP:REP 3->85|2azwA1|2.1e-10|20.5|83/0|d.113.1.1|1/1|Nudix| OP:NHOMO 50 OP:NHOMOORG 50 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1------------------------------------------------1---1----------1-------1111111111111111111111--11111111111111111111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 87 STR:RPRED 100.0 SQ:SECSTR HHHHHcEEEEEEEEEEEEEEEEEETTTTEEEEEEEEEEEEEEEEEccccccTccEEEEEcHHHHHHHcccHHHHHHHHHHHHccccc DISOP:02AL 85-88| PSIPRED ccEEEEEEEEHHHHHHHHHHHHHHcccccEEEcccEEEEEEEEEEEcccHHcccEEEEEcHHHHHHHHHHHHHHHHHHHHHHHcccc //