[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56410.1
DDBJ      :             transcriptional regulator, putative
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  572/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
a.4.5c.94.1
:322 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   23->214 3fzvB PDBj 3e-11 26.9 %
:RPS:PDB   20->231 1bi3A PDBj 1e-19 9.1 %
:RPS:SCOP  20->101 1b9mA1  a.4.5.8 * 6e-18 18.3 %
:RPS:SCOP  139->319 1al3A  c.94.1.1 * 9e-12 13.4 %
:HMM:SCOP  21->128 1b9mA1 a.4.5.8 * 4.1e-22 22.9 %
:HMM:SCOP  104->318 2esnA2 c.94.1.1 * 1.1e-21 19.9 %
:RPS:PFM   23->81 PF00126 * HTH_1 2e-09 37.3 %
:RPS:PFM   178->316 PF03466 * LysR_substrate 7e-04 25.4 %
:HMM:PFM   23->81 PF00126 * HTH_1 8.8e-21 37.3 59/60  
:HMM:PFM   140->318 PF03466 * LysR_substrate 3.8e-15 22.0 168/209  
:BLT:SWISS 21->230 YVBU_BACSU 1e-15 30.9 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56410.1 GT:GENE ACF56410.1 GT:PRODUCT transcriptional regulator, putative GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(612126..613094) GB:FROM 612126 GB:TO 613094 GB:DIRECTION - GB:PRODUCT transcriptional regulator, putative GB:NOTE identified by match to protein family HMM PF00126 GB:PROTEIN_ID ACF56410.1 GB:DB_XREF GI:194357962 LENGTH 322 SQ:AASEQ MLLIFLSSLAILRQVWYNKNMRIQQLHYIIKIVETGSMNEAAKQLFITQPSLSNAVRDLENEMGIEIFIRNPKGITLTRDGMEFLSYARQVVEQTQLLEERYKNPVAHRELFSVSSQHYAFVVNAFVSLLKKSDMEKYELFLRETRTWEIIDDVKNFRSEVGVLFLNSYNRDVLTKMLDDNHLLAHHLFTAQPHIFVSKTNPLAKKDKVKLSDLENFPYLSYDQGTHNSFYFSEEILSQEHHKKSIVVSDRATLFNLLIGLDGYTIATGILNSNLNGDNIVSIPLDIDDPIELVYIQHEKTSLSXMGERFIDYLLEEVQFDS GT:EXON 1|1-322:0| BL:SWS:NREP 1 BL:SWS:REP 21->230|YVBU_BACSU|1e-15|30.9|194/292| BL:PDB:NREP 1 BL:PDB:REP 23->214|3fzvB|3e-11|26.9|171/284| RP:PDB:NREP 1 RP:PDB:REP 20->231|1bi3A|1e-19|9.1|197/211| RP:PFM:NREP 2 RP:PFM:REP 23->81|PF00126|2e-09|37.3|59/60|HTH_1| RP:PFM:REP 178->316|PF03466|7e-04|25.4|138/207|LysR_substrate| HM:PFM:NREP 2 HM:PFM:REP 23->81|PF00126|8.8e-21|37.3|59/60|HTH_1| HM:PFM:REP 140->318|PF03466|3.8e-15|22.0|168/209|LysR_substrate| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00126|IPR000847| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00126|IPR000847| RP:SCP:NREP 2 RP:SCP:REP 20->101|1b9mA1|6e-18|18.3|82/122|a.4.5.8| RP:SCP:REP 139->319|1al3A|9e-12|13.4|172/237|c.94.1.1| HM:SCP:REP 21->128|1b9mA1|4.1e-22|22.9|105/0|a.4.5.8|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 104->318|2esnA2|1.1e-21|19.9|206/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 1753 OP:NHOMOORG 576 OP:PATTERN -------------------------------------------------------------------- 11--2---------1----------1-------1111246-211-1------321-------1--17121-2222111135631-1--111--------1-4-1111111----------------------------------2-1112111----------11-223-1-------------------12255555555625444643-877465612262--1333227E1223233133222336442821-2332-212342212-32-1332333322222332222222222222222222222222233332223-4-632222222-21-233111143--12241-KI-2-2-11-111---2--1-----------3131-22122111111111112-12-22322131-51121115713224-11216-1-2133--------2---11----------------------------------1-115537CAA7ED4555588BC555534B8C384A--7621235371335236111--1--------1-114211--1-2-1-211--1--1111--1-1112111-1----------------------221-11-1213235444432244323324222----1--------52532426665654576-666765476665755665477452-237375757766757555445465652-322222222222---21111111111132A22211121111-2215555641131226647647637876133521111111112434333333254511-1111-----------11--------------------------------------------------111 -------------3------------------------------------------------------------------------------------------------------------------------------------------------3------1----------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 318 STR:RPRED 98.8 SQ:SECSTR #cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTccccHHHHHHHHTccHHHHHHHHHHHHHTTcccEEEcTTccEEEcHHHHHHHHHHHHHHHHHHHHHHHTTcHHHHHHHHHHTTTccHHHHHHEEEHHHHcccccccTTccccTTHHHHTcccEEHHHHcccccEEcEEHHHHcccEEEEEccGGGccccTHHHHHHHTTccTTcEEEEccccEEEETTEEEEccHHHHHHHHHHHHTccEEEEEEccHHHHHHHHHHTccEEEEEGGGccTTTcTTcEEEEccTTccEEEEEEEETTccccHHHHHHHHHHcTTcc### DISOP:02AL 102-106,321-323| PSIPRED cEEEEEccHHHHHHHHHHccccHHHHHHHHHHHHHccHHHHHHHHccccHHHHHHHHHHHHHHccEEEEEccccEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHHHHHcccccEEEEEEccHHHHHHHHHcccccEEEEEccccccccEEEEcccccEEEEEEEcccEEEEEcccccccccccccHHHHccccEEEccccccHHHHHHHHHHHccccccEEEEccHHHHHHHHHHcccEEEHHHHHHHHcccccEEEEEcccccEEEEEEEEEccccccHHHHHHHHHHHHHHcccc //