[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56414.1
DDBJ      :             ABC transporter, ATP-binding protein
Swiss-Prot:             

Homologs  Archaea  44/68 : Bacteria  893/915 : Eukaryota  197/199 : Viruses  1/175   --->[See Alignment]
c.37.1f.37.1
:574 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->570 2hydA PDBj 1e-41 25.9 %
:RPS:PDB   1->571 3b60A PDBj 2e-49 17.8 %
:RPS:SCOP  1->315 2hydA2  f.37.1.1 * 7e-41 18.4 %
:RPS:SCOP  316->554 1pf4A1  c.37.1.12 * 2e-26 33.9 %
:HMM:SCOP  2->314 1pf4A2 f.37.1.1 * 5.7e-64 30.0 %
:HMM:SCOP  311->554 1pf4A1 c.37.1.12 * 1.2e-57 31.6 %
:RPS:PFM   20->284 PF00664 * ABC_membrane 2e-16 26.0 %
:RPS:PFM   376->499 PF00005 * ABC_tran 3e-10 40.5 %
:RPS:PFM   472->538 PF02463 * SMC_N 2e-06 32.8 %
:HMM:PFM   16->283 PF00664 * ABC_membrane 1.1e-35 24.6 268/275  
:HMM:PFM   373->499 PF00005 * ABC_tran 2.1e-22 34.2 114/118  
:HMM:PFM   362->380 PF01935 * DUF87 0.0002 63.2 19/229  
:BLT:SWISS 4->569 Y1304_MYCBO 4e-64 29.1 %
:PROS 471->485|PS00211|ABC_TRANSPORTER_1
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56414.1 GT:GENE ACF56414.1 GT:PRODUCT ABC transporter, ATP-binding protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1263517..1265241) GB:FROM 1263517 GB:TO 1265241 GB:DIRECTION - GB:PRODUCT ABC transporter, ATP-binding protein GB:NOTE identified by match to protein family HMM PF00005; match to protein family HMM PF00664 GB:PROTEIN_ID ACF56414.1 GB:DB_XREF GI:194357966 LENGTH 574 SQ:AASEQ MKHLLSYFKPYIKESILAPLFKLLEAVFELLVPMVIAGIVDQSLPQGDQGHLWMQIGLLLIFAVIGVLVALIAQFYSAKAAVGFAKELTNDLYRHILSLPKDSRDRLTTSSLVTRLTSDTYQIQTGINQFLRLFLRAPIIVFGAIFMAYRISAELTFWFLVMVAILTIVIVGLSRLVNPLYSSLRKKTDQLVQETRQQLQGTRVIRAFGQEKRELQIFQTLNQVYARLQEKTGFWSSLLTPLTYLIVNGTLLVIIWQGYISIQGGVLSQGALIALINYLLQILVELVKLAMLITSLNQSYISAKRIEEVFAESPENIHSELEQKQVTSDRVLQVQELTFTYPDAAQPSLRDISFDMTQGQILGIIGGTGSGKSSLVQLLLGLYPVDKGNIDLYQNGRSPLNLEQWRSWIAYVPQKVELFKGTIRSNLTLGFNQEVSDQELWQALEIAQAKDFVSEKEGLLDALVEAGGRNFSGGQKQRLSIARAVLRQAPFLILDDATSALDTITESKLLKAIRENFPNTSLILISQRTSTLQMADQILLLEKGELLAVGKHDDLMKSSQVYCEINASQHGKED GT:EXON 1|1-574:0| BL:SWS:NREP 1 BL:SWS:REP 4->569|Y1304_MYCBO|4e-64|29.1|563/582| PROS 471->485|PS00211|ABC_TRANSPORTER_1|PDOC00185| TM:NTM 6 TM:REGION 14->36| TM:REGION 54->76| TM:REGION 126->148| TM:REGION 154->176| TM:REGION 237->258| TM:REGION 273->295| SEG 103->120|srdrlttsslvtrltsdt| SEG 357->375|tqgqilgiiggtgsgkssl| BL:PDB:NREP 1 BL:PDB:REP 1->570|2hydA|1e-41|25.9|559/578| RP:PDB:NREP 1 RP:PDB:REP 1->571|3b60A|2e-49|17.8|569/572| RP:PFM:NREP 3 RP:PFM:REP 20->284|PF00664|2e-16|26.0|265/274|ABC_membrane| RP:PFM:REP 376->499|PF00005|3e-10|40.5|111/123|ABC_tran| RP:PFM:REP 472->538|PF02463|2e-06|32.8|67/536|SMC_N| HM:PFM:NREP 3 HM:PFM:REP 16->283|PF00664|1.1e-35|24.6|268/275|ABC_membrane| HM:PFM:REP 373->499|PF00005|2.1e-22|34.2|114/118|ABC_tran| HM:PFM:REP 362->380|PF01935|0.0002|63.2|19/229|DUF87| GO:PFM:NREP 9 GO:PFM GO:0005524|"GO:ATP binding"|PF00664|IPR001140| GO:PFM GO:0006810|"GO:transport"|PF00664|IPR001140| GO:PFM GO:0016021|"GO:integral to membrane"|PF00664|IPR001140| GO:PFM GO:0042626|"GO:ATPase activity, coupled to transmembrane movement of substances"|PF00664|IPR001140| GO:PFM GO:0055085|"GO:transmembrane transport"|PF00664|IPR001140| GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| GO:PFM GO:0005524|"GO:ATP binding"|PF02463|IPR003395| GO:PFM GO:0005694|"GO:chromosome"|PF02463|IPR003395| RP:SCP:NREP 2 RP:SCP:REP 1->315|2hydA2|7e-41|18.4|315/323|f.37.1.1| RP:SCP:REP 316->554|1pf4A1|2e-26|33.9|239/244|c.37.1.12| HM:SCP:REP 2->314|1pf4A2|5.7e-64|30.0|307/311|f.37.1.1|1/1|ABC transporter transmembrane region| HM:SCP:REP 311->554|1pf4A1|1.2e-57|31.6|244/244|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 12931 OP:NHOMOORG 1135 OP:PATTERN ----1-112221112213----11622343324-----1----2141711751-56523134--2--- 74E3H79599964554655-55229B5555565666DJ782D8IBDC89755ABD35B22BG76E39KMQ89888DAAE4TG4614337853-435A--53B754F6G7A1121111111111129668D99DB79799BB323I1JDFGEDA4488D897A9AB7GMVVB5D788879585854822FB4A5BEEHDHHKK9EGHHGHJGIICHHGM559EIEFFEEEFDIQ988A8A99989989997558MO8FGLG7LBSFF66NNC6688FDACBDFPKGKLHIHMJHFDJKFHFBDBABCCDEDDACHIICBDGGICIEEEHJJJKJIH9JCGEHH6CBCVA9ILDGC21ZYF336652499DF77981356664654662FDBE896FBDAABACBBBA7AI-DDHDEFFFBK73QGGIIIGKJGEJB956599IBBBCBC79999999996878A7C222222223347446745665544532511446236875AAAABBB89AA9AAA9BBBA8999BB8A434878B867566E6987AB4A47A523335337678867583738657833413758448382252BB4A622264555442133333336525787A99983B486C7ABBAA98999A9B9DB88--74764222222A58A986577B59B855-7555557577799555557AADFHFLB7858677678787887C547555563EGHHIHFFFGIG1163354338AB941C4C8777875899857796757757436AE7996DF978CB9A6ABA4444454344ABBECCCCBEEEGH457566577844442283664444--------p-F32326-533-752---53741444486G65BCAEA263 5555OKF-OA65OQLGJMHLNSPbPZOFFCDDDPQNEKMJIIHBBBMLPYSRcTIINJGHGIGCB7892E95CAEBB2AC7998EB69-OdCJIMMEDEICBGNME4Eqa*RaRkXmJFFIIPGYbGrE**a1kOoGIGDWGL*WFHIHDSDC*GQIOVJb*JhPHMhLQ*lepZ7FC9*777GDcba*HlrDIoZffK ------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------ STR:NPRED 574 STR:RPRED 100.0 SQ:SECSTR HHHHHHHHGGGHHHHHHHHHHHHHHHHHHHHHHHHHTHHHHccTTcTTHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTcccTHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTHHHHHHHTcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccTTcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEcccccEEEEEEEEcccccccccEEEEEEEEcTTcEEEEEEcTTccHHHHHHHHTTTTcccEEEEEETTEETTTccHHHHHHTEEEEccccccccccHHHHHHTTTTccccHHHHHHHHHTTTcHHHHHHcTTGGGccccTTcccccHHHHHHHHHHHHHHHcccEEEEETTTccccHHHHHHHHHHHHHHHTTcEEEEEcccGGGTTTccEEEEEETTEEEEEEcHHHHHHHTccHHHHHHHTccccc DISOP:02AL 313-327,570-575| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccEEEEEEEEEEcccccHHHccccEEEEccccEEEEEccccccHHHHHHHHHHcccccccEEEEccEEHHHccHHHHHHHccEEccccccccccHHHHHHccccccccHHHHHHHHHHHccHHHHHHccHHHccccccccccccHHHHHHHHHHHHHHccccEEEEEHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccHHHHHcccEEEEEEccEEEEEccHHHHHHcccHHHHHHHHHHcccc //