[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56418.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  35/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:197 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->75 PF08006 * DUF1700 8e-14 52.0 %
:HMM:PFM   1->188 PF08006 * DUF1700 1.1e-20 26.9 175/181  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56418.1 GT:GENE ACF56418.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(98212..98805) GB:FROM 98212 GB:TO 98805 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF56418.1 GB:DB_XREF GI:194357970 LENGTH 197 SQ:AASEQ MTRTEYLTQLELYLKKLPEADRIEAMDYFRELFDDAGVEGEEELIASLGTPKAAAHEVLSNLLDKKINEAPAQKNNRQILHIALLALLAAPIGIPLGIAILVTLFAILVAALTVILAFFAVSILGIIGGFLFLVESFTILAQAKSAFILIFGSGLLAIGASSLVLLGISYVARFFGLLIVRLVQFVLKKGKRGNQHA GT:EXON 1|1-197:0| TM:NTM 2 TM:REGION 99->121| TM:REGION 157->179| SEG 79->121|ilhiallallaapigiplgiailvtlfailvaaltvilaffav| RP:PFM:NREP 1 RP:PFM:REP 1->75|PF08006|8e-14|52.0|75/177|DUF1700| HM:PFM:NREP 1 HM:PFM:REP 1->188|PF08006|1.1e-20|26.9|175/181|DUF1700| OP:NHOMO 39 OP:NHOMOORG 35 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---111111111111111111111111111121---2221---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,65-80,188-198| PSIPRED ccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccc //