[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56423.1
DDBJ      :             L-Asparaginase, putative
Swiss-Prot:             

Homologs  Archaea  66/68 : Bacteria  540/915 : Eukaryota  129/199 : Viruses  0/175   --->[See Alignment]
c.88.1
:320 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->305 1jjaB PDBj 3e-38 40.1 %
:RPS:PDB   1->319 2d6fA PDBj 1e-54 25.2 %
:RPS:SCOP  3->315 1zq1A2  c.88.1.1 * 1e-76 28.1 %
:HMM:SCOP  1->321 4pgaA_ c.88.1.1 * 2.3e-97 42.6 %
:RPS:PFM   4->309 PF00710 * Asparaginase 4e-45 39.8 %
:HMM:PFM   4->312 PF00710 * Asparaginase 5.5e-86 30.6 301/313  
:BLT:SWISS 4->298 ASPG_DEIRA 6e-50 42.9 %
:PROS 7->15|PS00144|ASN_GLN_ASE_1
:PROS 78->88|PS00917|ASN_GLN_ASE_2
:PROS 5->22|PS01076|ACETATE_KINASE_2

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56423.1 GT:GENE ACF56423.1 GT:PRODUCT L-Asparaginase, putative GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 1811276..1812238 GB:FROM 1811276 GB:TO 1812238 GB:DIRECTION + GB:PRODUCT L-Asparaginase, putative GB:NOTE identified by match to protein family HMM PF00710 GB:PROTEIN_ID ACF56423.1 GB:DB_XREF GI:194357975 LENGTH 320 SQ:AASEQ MPKKILVLHTGGTISMQADASGAVVTSSDNPMNHVSNPLEGIQVHALDFFNLPSPHIKPKHMLVLYQKIKEEADNYDGVVITHGTDTLEETAYFLDTMEVPHMPIVLTGAMRSSNELGSDGVYNYLSALRVASDDRAADKGVLVVMNDEIHAAKYVTKTHTTNVNTFQTPTHGPLGLIMKQEILYFKTAEPRVRFDLDHIQGLVPIISAYAGMTDELIDMLDLEHLDGLIIQAFGAGNIPKETAQKLESLLQKGIPVALVSRCFNGIAEPVYAYQGGGVQLQKAGVFFVKELNAQKARLKLLIALNAGLTGQALKDYMEG GT:EXON 1|1-320:0| BL:SWS:NREP 1 BL:SWS:REP 4->298|ASPG_DEIRA|6e-50|42.9|287/322| PROS 7->15|PS00144|ASN_GLN_ASE_1|PDOC00132| PROS 78->88|PS00917|ASN_GLN_ASE_2|PDOC00132| PROS 5->22|PS01076|ACETATE_KINASE_2|PDOC00826| BL:PDB:NREP 1 BL:PDB:REP 5->305|1jjaB|3e-38|40.1|279/304| RP:PDB:NREP 1 RP:PDB:REP 1->319|2d6fA|1e-54|25.2|317/424| RP:PFM:NREP 1 RP:PFM:REP 4->309|PF00710|4e-45|39.8|299/315|Asparaginase| HM:PFM:NREP 1 HM:PFM:REP 4->312|PF00710|5.5e-86|30.6|301/313|Asparaginase| GO:PFM:NREP 1 GO:PFM GO:0006520|"GO:cellular amino acid metabolic process"|PF00710|IPR006034| RP:SCP:NREP 1 RP:SCP:REP 3->315|1zq1A2|1e-76|28.1|310/363|c.88.1.1| HM:SCP:REP 1->321|4pgaA_|2.3e-97|42.6|317/330|c.88.1.1|1/1|Glutaminase/Asparaginase| OP:NHOMO 1008 OP:NHOMOORG 735 OP:PATTERN 111111111111111111111111111-112111111111111111111111112222212-111111 -----122111-1111111-1111111111111-1--122----2-1--11-----1---21---11----1------11112-----3332-111---1211111-111--------------------------11111---1------------11111---------------------111------12222222121122222113222221111111111111112111111111111111111111111111-11111111111111111111111111111111111111111111111111111211111111-11111111111111-1---11111--1-1---11-----1--111--1--------11111-11----------12222222221-22322222----111------1--1------111-1-1-11111111--------------------------------------1---1111-11111112111111212111111122222-111122222322-21121--------111-1---12-----1-1-1-1-----------------11---3211111111111111111-1--1--2211--11-111222212111111111111--1----------21222112222222222-222232222222222222222133222333233333332323322222222--222222222222---1-----1111--1122221111-1111---1111111---1-11111111122221---222122212-12221111122111------------------------------------------------------------11-11------1- ----11--21-2---123-22221212--11-111111-11111112211435322111111-12111-11112115111111111-1--112111111-3-11---1-12111-21-----1-11-1-221-112----1--1---------3-1111----2-11211-1431-111D2-12-----1--2--111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 319 STR:RPRED 99.7 SQ:SECSTR cccEEEEEEcccccccEEcTTTccEEccTHHHHHcGGGGGTcEEEccccccccGGGccHHHHHHHHHHHHHHHTTccEEEEEccTTTHHHHHHHHHHHEEccccEEEEcccccTTcTTcTHHHHHHHHHHHHHccccEEEcccccccEEEEEGGGEEEcccccTTcEEEccccccEEEETTEEcccccccccccEEcccccccEEEEEccTTccHHHHHHHHHTTccEEEEEEcTTTcccGGGHHHHHHHHHTTccEEEEETTccccccTTccHHccHHHHHHTTcEEcTTccHHHHHHHHHHHTTTcccHHHHHHHHH# DISOP:02AL 1-1| PSIPRED cccEEEEEEccccccEEEcccccccccHHHHHHHHHHHHcccEEEEEEEcccccHHccHHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHcccccEEEEccccccccccccHHHHHHHHHHHHHccccccccEEEEEccEEEcccEEEEEEccccccccccccccEEEEEccEEEEEcccccccccccccccccEEEEEEcccccHHHHHHHHHccccEEEEEEEccccccHHHHHHHHHHHHcccEEEEEEcccccccccccccccccHHHHHccEEEcccccHHHHHHHHHHHHHccccHHHHHHHHcc //