[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56431.1
DDBJ      :             ABC transporter, ATP-binding protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:86 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   24->78 PF03950 * tRNA-synt_1c_C 0.001 20.8 53/173  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56431.1 GT:GENE ACF56431.1 GT:PRODUCT ABC transporter, ATP-binding protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1327554..1327814) GB:FROM 1327554 GB:TO 1327814 GB:DIRECTION - GB:PRODUCT ABC transporter, ATP-binding protein GB:NOTE contains potential frameshift GB:PROTEIN_ID ACF56431.1 GB:DB_XREF GI:194357983 LENGTH 86 SQ:AASEQ MTFQKVGKDSHNFLFEIAFSSATDRDIFITKQEFGDIVQEEGLRITMSGNIQSSELFKFFNENSIKVVDFETKKETLKDIYLNRSK GT:EXON 1|1-86:0| HM:PFM:NREP 1 HM:PFM:REP 24->78|PF03950|0.001|20.8|53/173|tRNA-synt_1c_C| OP:NHOMO 10 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2112111-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7,85-87| PSIPRED ccHHHccccccEEEEEEEEccccccEEEEEHHHHHHHHHHccEEEEEEccccHHHHHHHHccccEEEEEEHHHHHHHHHHHHcccc //