[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56432.1
DDBJ      :             oligopeptide ABC transporter, oligopeptide-binding protein
Swiss-Prot:ALIB_STRR6   RecName: Full=Oligopeptide-binding protein aliB;Flags: Precursor;

Homologs  Archaea  7/68 : Bacteria  461/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:652 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   41->507 2z23A PDBj 1e-30 30.0 %
:RPS:PDB   23->579 1b0hA PDBj 4e-50 23.1 %
:RPS:SCOP  33->579 1dpeA  c.94.1.1 * 7e-51 20.0 %
:HMM:SCOP  21->593 1jetA_ c.94.1.1 * 2.7e-78 25.4 %
:RPS:PFM   75->520 PF00496 * SBP_bac_5 2e-26 32.0 %
:HMM:PFM   76->519 PF00496 * SBP_bac_5 3.3e-53 26.8 362/372  
:BLT:SWISS 1->652 ALIB_STRR6 0.0 99.5 %
:PROS 81->103|PS01040|SBP_BACTERIAL_5
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56432.1 GT:GENE ACF56432.1 GT:PRODUCT oligopeptide ABC transporter, oligopeptide-binding protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1403048..1405006) GB:FROM 1403048 GB:TO 1405006 GB:DIRECTION - GB:PRODUCT oligopeptide ABC transporter, oligopeptide-binding protein GB:NOTE identified by match to protein family HMM PF00496 GB:PROTEIN_ID ACF56432.1 GB:DB_XREF GI:194357984 LENGTH 652 SQ:AASEQ MKKSKSKYLTLAGLVLGTGVLLSACGNSSTASKTYNYVYSSDPSSLNYLAENRAATSDIVANLVDGLLENDQYGNIIPSLAEDWTVSQDGLTYTYKLRKDAKWFTSEGEEYAPVTAQDFVTGLQYAADKKSEALYLVQDSVAGLDDYITGKTSDFSTVGVKALDDQTVQYTLVKPELYWNSKTLATILFPVNADFLKSKGDDFGKADPSSILYNGPFLMKALVSKSAIEYKKNPNYWDAKNVFVDDVKLTYYDGSDQESLERNFTAGAYTTARLFPNSSSYEGIKEKYKNNIIYSMQNSTSYFFNFNLDRKSYNYTSKTSDIEKKSTQEAVLNKNFRQAINFAFDRTSYGAQSEGKEGATKILRNLVVPPNFVSIKGKDFGEVVASKMVNYGKEWQGINFADGQDPYYNPEKAKAKFAEAKKELEAKGVQFPIHLDKTVEVTDKVGIQGVSSIKQSIESVLGSDNVVIDIQQLTSDEFDSSGYFAQTAAQKDYDLYHGGWGPDYQDPSTYLDIFNTNSGGVLXNLGLEPGEXNDKAKAVGLDVYTQMLEEANKEQDPAKRYEKYADIQAWLIDSSLVLPSVSRGGTPSLRRTVPFAAAYGLTGTKGVESYKYLKVQDKIVTTDEYAKAREKWLKEKEESNKKAQEELAKHVK GT:EXON 1|1-652:0| SW:ID ALIB_STRR6 SW:DE RecName: Full=Oligopeptide-binding protein aliB;Flags: Precursor; SW:GN Name=aliB; OrderedLocusNames=spr1382; SW:KW Cell membrane; Complete proteome; Lipoprotein; Membrane; Palmitate;Peptide transport; Protein transport; Signal; Transport. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->652|ALIB_STRR6|0.0|99.5|652/652| GO:SWS:NREP 5 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0015833|"GO:peptide transport"|Peptide transport| GO:SWS GO:0015031|"GO:protein transport"|Protein transport| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 81->103|PS01040|SBP_BACTERIAL_5|PDOC00799| SEG 9->22|ltlaglvlgtgvll| SEG 411->427|ekakakfaeakkeleak| BL:PDB:NREP 1 BL:PDB:REP 41->507|2z23A|1e-30|30.0|400/517| RP:PDB:NREP 1 RP:PDB:REP 23->579|1b0hA|4e-50|23.1|476/517| RP:PFM:NREP 1 RP:PFM:REP 75->520|PF00496|2e-26|32.0|359/366|SBP_bac_5| HM:PFM:NREP 1 HM:PFM:REP 76->519|PF00496|3.3e-53|26.8|362/372|SBP_bac_5| GO:PFM:NREP 2 GO:PFM GO:0005215|"GO:transporter activity"|PF00496|IPR000914| GO:PFM GO:0006810|"GO:transport"|PF00496|IPR000914| RP:SCP:NREP 1 RP:SCP:REP 33->579|1dpeA|7e-51|20.0|469/507|c.94.1.1| HM:SCP:REP 21->593|1jetA_|2.7e-78|25.4|493/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 1412 OP:NHOMOORG 472 OP:PATTERN 11-----------------1---1--------------------------111--------------- --1-----------------------------------11---3-1-----------1--1--------1--111211----1-1-11------------------1--111111113333333----------1-12211--1331-1-11-11-----------31131------------31---22-222CDEDFCEEAEEFCCD5-2222FEF2124154433335H211111112111111111111D796575--2-77--66222143343333233241134444444444-1111111111115--762---21215222222222232-2232223-1111-1--11-----1--2251-15-1----------21118------1-22232232227-1121121254--74462124433421-12-134134-----------------62----------------------------------------311313-111111321111-22162111-------------111-------31--------------------------------11----------------------1-----1-1-------44---2----------1---------------1-1--------45544544444443434-4443444343444444443454756643323333333333334622433334-544444444444---------------412444122-33324-23--------14-13333212312122-4321-11-11---11122222233211-----------------G------555252123--------------------------------2221124- -------------1------------------------------------------------------------------------------------------------------------------------------------------------1----1---------------------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 571 STR:RPRED 87.6 SQ:SECSTR ######################ccTTcccccccEEEEEcccccccccTTccccHHHHHHHHHHccccEEEcTTccEEEccEEEEEEEETTTEEEEEEcTTcccTTccccccccccHHHHHHHHHHHHcGGGcTTHHHHTTcTTHHHHHTTccHcGGGccEEEEETTEEEEEcccccTTGGGGGGcGGGccccHHHHHHHGGGGcTGcTTTccccccEEEEEEETTTEEEEEEcTTcTTGGGccccEcEEEEEccccHHHHHHHHHTTccccccccccTTTHHHHHHHcGGGEEEEEEEEEEEEEEEcTTcTTTTTTETTTTEEEcccccGGGcHHHHHHHHHHccHHHHHHTTTTHHHHHTTTccccEEccccccTTcTTccccHHHcTTccccccHcccHHHccHHHHHHHHHHHHHHTHHHHHHTTcTcccccccEEEEEEEccHHHHHHHHHHHHHHHHHHccEEEEEEEcHHHHHcHHHHHHHHHHTcccEEEEEEEcccccTHHHHGGGcTTcTTcccccccHHccccHHHTcTTHHHHHHHHHHHTccccHHHHHHHHHHHHHHHHHTTcEEEEEEEEEEEEEETTE########################################################### DISOP:02AL 1-5,26-34,634-647,649-649,651-653| PSIPRED cccHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEEccccccccccEEcccHHHHHHHHHHHHHEEEcccccEEEcEEEEEEEcccccEEEEEEccccEEccccccccccccHHHHHHHHHHHHcccccccHHHHHHHccHHHHHccccccccccEEEEccccEEEEEEccccHHHHHHHHHHHHHHccHHHHHHcccccccccccccEEEccEEEEEEEcccEEEEEEcccccccccccccEEEEEEEEcccHHHHHHHHHccccEEEEccccHHHHHHHHHcccccEEEEccccEEEEEEEEccccccccccccccccccccccccccHHHHHHHHHHccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccHHccccEEEEEEEEccccccccHHHHHHHHHHHHHHHHHHcccEEEEEEEEEHHHHHHHHHHHHHcccccEEEEEEEcccccccHHHHHHHHccccccccccccccccccccHHHHcccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccEEEEEEEccEEEEEcccccccccccccccccccEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //