[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56435.1
DDBJ      :             IS630-Spn1, transposase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  31/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.1a.4.5
:125 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   8->60 3bp8B PDBj 3e-04 11.3 %
:RPS:PDB   45->110 1b4uB PDBj 6e-04 18.5 %
:RPS:SCOP  3->83 1pdnC  a.4.1.5 * 7e-07 17.3 %
:RPS:SCOP  62->120 1xcbA1  a.4.5.38 * 3e-04 8.8 %
:HMM:SCOP  2->99 1pdnC_ a.4.1.5 * 4.6e-14 27.6 %
:RPS:PFM   3->104 PF01710 * Transposase_14 5e-29 55.9 %
:HMM:PFM   1->119 PF01710 * Transposase_14 3.2e-57 54.8 115/120  
:BLT:SWISS 16->105 SETMR_HUMAN 7e-05 27.8 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56435.1 GT:GENE ACF56435.1 GT:PRODUCT IS630-Spn1, transposase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1831761..1832138) GB:FROM 1831761 GB:TO 1832138 GB:DIRECTION - GB:PRODUCT IS630-Spn1, transposase GB:NOTE identified by match to protein family HMM PF01710 GB:PROTEIN_ID ACF56435.1 GB:DB_XREF GI:194357987 LENGTH 125 SQ:AASEQ MAYSIDFRKKVLSYCERTGSITEASHVFQISRNTIYGWLKLKEKTGELNHQVKGTKPRKVDRDRLKNYLTDNPDAYLTEIASEFGCHPTTIHYALKAMGYTRKKDHTYYEQDPEKVPYFLKILIV GT:EXON 1|1-125:0| BL:SWS:NREP 1 BL:SWS:REP 16->105|SETMR_HUMAN|7e-05|27.8|90/100| RP:PDB:NREP 2 RP:PDB:REP 8->60|3bp8B|3e-04|11.3|53/380| RP:PDB:REP 45->110|1b4uB|6e-04|18.5|65/298| RP:PFM:NREP 1 RP:PFM:REP 3->104|PF01710|5e-29|55.9|102/114|Transposase_14| HM:PFM:NREP 1 HM:PFM:REP 1->119|PF01710|3.2e-57|54.8|115/120|Transposase_14| RP:SCP:NREP 2 RP:SCP:REP 3->83|1pdnC|7e-07|17.3|81/123|a.4.1.5| RP:SCP:REP 62->120|1xcbA1|3e-04|8.8|57/74|a.4.5.38| HM:SCP:REP 2->99|1pdnC_|4.6e-14|27.6|98/0|a.4.1.5|1/1|Homeodomain-like| OP:NHOMO 208 OP:NHOMOORG 31 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------4-----------------------5-15K-----------Q-----7----------------------------------------------------------------------------------------------------------------------8835437-467--------------44---444--------------------------------------------------3------------------------------------------------------------------------------------------------------2Q----------------------------------------------------------------------------------21------------------------------------------------------------------------------------------------------3----------------------------------------------------------------------------------------------O-------------------------------------22--------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 109 STR:RPRED 87.2 SQ:SECSTR #HHTccHHHHHHHHTTTcccccHHHHHTTccccTTTHHHHHHHTTTcEEEcccEEEccccccccEEEEEcHHHHHHHHHHHcTTGGGGHHHHHHHHTccccEEEEEEEEE############### DISOP:02AL 1-1,43-63,108-110,112-113| PSIPRED ccccHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHcccccHHHHHHHccccHHHHHHHHHHcccccccccccHHccccHHHHHHHHHcc //