[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56436.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  166/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:255 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   14->99 PF12051 * DUF3533 2e-15 45.9 %
:HMM:PFM   14->168 PF12051 * DUF3533 2.6e-10 21.2 151/382  
:HMM:PFM   122->215 PF04085 * MreC 0.00019 19.4 93/154  
:BLT:SWISS 1->254 YHGE_BACSU 2e-23 25.2 %
:TM
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56436.1 GT:GENE ACF56436.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(2072045..2072812) GB:FROM 2072045 GB:TO 2072812 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE identified by glimmer; putative GB:PROTEIN_ID ACF56436.1 GB:DB_XREF GI:194357988 LENGTH 255 SQ:AASEQ MIGISLIPDLYNIIFLSSMWDPYGQLSDLPVAVVNNDKEASYNGNTMAIGKDMVSNLKENKTLDFHFVDEEEGKKGLEDGDYYMVVTLPSDLSKKTTTLSNIQSTAAYQSLTSEQQTGISDSVSQNSTDSIQSAQSIVALVQGLQGSLENLQNQSSNLSTLKNQANQVLPITSTSLIGLSSGLTEIQGAVTSKLVPASQLIASGVNAYTTGVDKVSQGASQLSEKNATLTGSLDKLVSGSNTLTQKSSRLTAGVG GT:EXON 1|1-255:0| BL:SWS:NREP 1 BL:SWS:REP 1->254|YHGE_BACSU|2e-23|25.2|254/775| COIL:NAA 19 COIL:NSEG 1 COIL:REGION 141->159| TM:NTM 1 TM:REGION 1->23| SEG 69->81|deeegkkgledgd| SEG 171->184|itstsliglssglt| RP:PFM:NREP 1 RP:PFM:REP 14->99|PF12051|2e-15|45.9|85/350|DUF3533| HM:PFM:NREP 2 HM:PFM:REP 14->168|PF12051|2.6e-10|21.2|151/382|DUF3533| HM:PFM:REP 122->215|PF04085|0.00019|19.4|93/154|MreC| OP:NHOMO 253 OP:NHOMOORG 168 OP:PATTERN --------------------------------1-1--------------------------------- ------1-111121111---------------1----1------------------1---------11-1-2------2-1-------------------------------------------------------------------------------------------------------11-----1113333333313333331111113332212111111211121111111111111111111-1-3-23-1---3211221111212-2111111111111-11-1111111111111111111111211111---333333333333112212221-----1-----------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 96-112,162-181,221-243,255-256| PSIPRED cEEEEEHHHHHHHHHHHHHcccccccccccEEEEEcccccccccEEHHHHHHHHHHHHHcccccEEEccHHHHHHHHHHccEEEEEEEccHHHHHHHHHccccccccEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //