[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56441.1
DDBJ      :             transcriptional regulator, PadR family
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  156/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:106 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->99 3hhhB PDBj 5e-26 50.5 %
:RPS:PDB   5->97 2e1nB PDBj 2e-08 24.7 %
:RPS:SCOP  11->102 1yg2A  a.4.5.61 * 2e-09 13.3 %
:HMM:SCOP  4->104 1xmaA_ a.4.5.61 * 1.5e-20 28.7 %
:RPS:PFM   10->85 PF03551 * PadR 3e-09 42.1 %
:HMM:PFM   6->85 PF03551 * PadR 1.1e-23 37.5 80/86  
:BLT:SWISS 1->105 YX_BACSH 2e-10 28.6 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56441.1 GT:GENE ACF56441.1 GT:PRODUCT transcriptional regulator, PadR family GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 699085..699405 GB:FROM 699085 GB:TO 699405 GB:DIRECTION + GB:PRODUCT transcriptional regulator, PadR family GB:NOTE identified by match to protein family HMM PF03551 GB:PROTEIN_ID ACF56441.1 GB:DB_XREF GI:194357993 LENGTH 106 SQ:AASEQ MKETQLLKGVLEGCVLDMIGQKERYGYELVQTLREAGFDTIVPGTIYPLLQKLEKNQWIRGDMRPSPDGPDRKYFSLMKEGEERVSVFWQQWDDLSQKVEGIKNGG GT:EXON 1|1-106:0| BL:SWS:NREP 1 BL:SWS:REP 1->105|YX_BACSH|2e-10|28.6|105/109| BL:PDB:NREP 1 BL:PDB:REP 2->99|3hhhB|5e-26|50.5|97/101| RP:PDB:NREP 1 RP:PDB:REP 5->97|2e1nB|2e-08|24.7|93/112| RP:PFM:NREP 1 RP:PFM:REP 10->85|PF03551|3e-09|42.1|76/84|PadR| HM:PFM:NREP 1 HM:PFM:REP 6->85|PF03551|1.1e-23|37.5|80/86|PadR| RP:SCP:NREP 1 RP:SCP:REP 11->102|1yg2A|2e-09|13.3|83/169|a.4.5.61| HM:SCP:REP 4->104|1xmaA_|1.5e-20|28.7|101/0|a.4.5.61|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 273 OP:NHOMOORG 159 OP:PATTERN -------------------------------------------1---1---1---------------- -11-3-1-------------------------------------13---11-31---1---1-1-11-11----------1-------1111-1-----1111111-1-1---------------------------------------------------------------------------1------115555558628656453211225371-1-2-122222222---------------2211-1---32-----111122----111121111------11111111111--------------11---111--112-1111111-111132----21111-----33-------1-----------111---------1-----------------------------1--1--1---1----------------------------11----------------------------------------------------1111----111111------------------------------1-----------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 103 STR:RPRED 97.2 SQ:SECSTR #cHHEccHHHHHHHHHHHHTTccEEHHHHHHHHHHHcTTEccHHHHHHHHHHHHHTTcEEEEEEcTTccccEEEEEEccccccHHHHHHHHHHHHHHHTTTccc## DISOP:02AL 1-5,66-68,106-107| PSIPRED ccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHcccccccHHHHHHHHHHHHHcccEEEEEEEccccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHccc //