[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56445.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  27/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:53 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56445.1 GT:GENE ACF56445.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1124342..1124503) GB:FROM 1124342 GB:TO 1124503 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF56445.1 GB:DB_XREF GI:194357997 LENGTH 53 SQ:AASEQ MVDKDGKLIPEQGGARSTSPAPVVIRKGLDIDKIMMHLSDTFNSWDYRQVEYY GT:EXON 1|1-53:0| OP:NHOMO 27 OP:NHOMOORG 27 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------11-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------11-----------11111111-1-11--------------111111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED ccccccccccccccccccccccEEEEccccHHHHHHHHHHHHccccccccccc //