[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56449.1
DDBJ      :             Tn5253 conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  13/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:94 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   43->84 PF00373 * FERM_M 0.00023 24.4 41/117  
:BLT:SWISS 2->90 Y1058_BACLD 2e-04 34.1 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56449.1 GT:GENE ACF56449.1 GT:PRODUCT Tn5253 conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1231717..1232001) GB:FROM 1231717 GB:TO 1232001 GB:DIRECTION - GB:PRODUCT Tn5253 conserved hypothetical protein GB:PROTEIN_ID ACF56449.1 GB:DB_XREF GI:194358001 LENGTH 94 SQ:AASEQ MMEDTYYQLEEALVQGFQTPEEYQAYKELKEHYEEVTGDYSFSKRELTSQLEIALQNHQGVDFEEHEKEEYLDLVQKLEEFDSSLATHYRQLID GT:EXON 1|1-94:0| BL:SWS:NREP 1 BL:SWS:REP 2->90|Y1058_BACLD|2e-04|34.1|82/100| HM:PFM:NREP 1 HM:PFM:REP 43->84|PF00373|0.00023|24.4|41/117|FERM_M| OP:NHOMO 13 OP:NHOMOORG 13 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1--11------111-1--1--------------11---1-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED cHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //