[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56453.1
DDBJ      :             transcriptional activator, Rgg/GadR/MutR family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  51/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.35.1
:283 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   156->282 3ffzB PDBj 2e-04 33.1 %
:RPS:PDB   4->283 2axuF PDBj 5e-16 12.5 %
:RPS:SCOP  1->40 2o38A1  a.35.1.13 * 5e-05 17.5 %
:HMM:SCOP  3->67 2awiA1 a.35.1.11 * 2.7e-11 30.8 %
:HMM:PFM   10->62 PF01381 * HTH_3 7e-06 33.3 51/55  
:BLT:SWISS 6->279 RGG_STRGC 3e-16 24.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56453.1 GT:GENE ACF56453.1 GT:PRODUCT transcriptional activator, Rgg/GadR/MutR family GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(937570..938421) GB:FROM 937570 GB:TO 938421 GB:DIRECTION - GB:PRODUCT transcriptional activator, Rgg/GadR/MutR family GB:NOTE identified by match to protein family HMM TIGR01716 GB:PROTEIN_ID ACF56453.1 GB:DB_XREF GI:194358005 LENGTH 283 SQ:AASEQ MKSKLGITLRKVRKGKQISLCSVADEHLSKXQISRFERGESEISCIXLINILDXLHITLDEFLILHDEDYTKTESFANLIQYIRKQYSLQNINNIQSLLSDSSNYTLDSFEKTMVKSILHTMDSRIIPSDDELLQLADYLFKVEKWGYYEIILLGNCVRTINYNSYFLLTKEMLNNYIYSSLNKTNKRIVTQLAINCFILSIDKEEFSNCSYLINEIKGLLENELNFYEQTVFLYATGYYEFKRQLSSGIETMKQAIQVLDILGEDKLKLHYTSHFDKLVNNK GT:EXON 1|1-283:0| BL:SWS:NREP 1 BL:SWS:REP 6->279|RGG_STRGC|3e-16|24.3|268/297| SEG 46->59|ixlinildxlhitl| BL:PDB:NREP 1 BL:PDB:REP 156->282|3ffzB|2e-04|33.1|121/1238| RP:PDB:NREP 1 RP:PDB:REP 4->283|2axuF|5e-16|12.5|279/297| HM:PFM:NREP 1 HM:PFM:REP 10->62|PF01381|7e-06|33.3|51/55|HTH_3| RP:SCP:NREP 1 RP:SCP:REP 1->40|2o38A1|5e-05|17.5|40/89|a.35.1.13| HM:SCP:REP 3->67|2awiA1|2.7e-11|30.8|65/0|a.35.1.11|1/1|lambda repressor-like DNA-binding domains| OP:NHOMO 132 OP:NHOMOORG 51 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------1----------1---1--3122223544322133242232323333333333333311666111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 283 STR:RPRED 100.0 SQ:SECSTR HHHcHHHHHHHHHHHTTccHHHHHTTTTcHHHHHHHHTTcccccHHHHHHHHHHHTccHHHHHHTTTccccHHHHHHHHHHHHHTcTTccHHHHHHHGGGTTccHHHHHHHHHHHHHHHHHTcccHHHHTTHHHHHHHHHcccccccHHHHHHHHHHHHHccHHHHHHHHGGccccccccHHHHHHHHHHHHHHHHHHHHTcHHHHHHHHHHHHHHTTcTTccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHTTcHHHHHHHHHHHHHHHHHH DISOP:02AL 1-2,282-284| PSIPRED cccHHHHHHHHHHHHccccHHHHHcccccHHHHHHHHcccccccHHHHHHHHHHccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcc //