[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56454.1
DDBJ      :             transporter, cation channel family
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  101/915 : Eukaryota  10/199 : Viruses  0/175   --->[See Alignment]
f.14.1
:247 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   158->212 1zwiC PDBj 2e-13 47.3 %
:RPS:PDB   155->219 2atkC PDBj 7e-14 26.2 %
:RPS:SCOP  43->213 1orqC  f.14.1.1 * 4e-20 23.1 %
:HMM:SCOP  2->215 1orqC_ f.14.1.1 * 8.8e-38 29.9 %
:RPS:PFM   158->211 PF07885 * Ion_trans_2 1e-06 38.9 %
:HMM:PFM   141->212 PF07885 * Ion_trans_2 2.4e-19 36.1 72/79  
:HMM:PFM   72->159 PF03268 * DUF267 0.00018 20.5 83/353  
:HMM:PFM   191->243 PF06295 * DUF1043 0.00039 25.0 52/128  
:BLT:SWISS 36->244 KCNF1_MOUSE 3e-14 30.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56454.1 GT:GENE ACF56454.1 GT:PRODUCT transporter, cation channel family GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1092171..1092914) GB:FROM 1092171 GB:TO 1092914 GB:DIRECTION - GB:PRODUCT transporter, cation channel family GB:NOTE identified by match to protein family HMM PF00520; match to protein family HMM PF07885 GB:PROTEIN_ID ACF56454.1 GB:DB_XREF GI:194358006 LENGTH 247 SQ:AASEQ MNKKWLFADYYDTTIILLALISVILVLLGFAEMIDLDNPPYSIIDLVIWGVFVIDYSWRFFTTKRKWRFILENIFDLLAILPLNAIFTVFRLGRIFRLTKLTKLLKLTRLLRIIGLTGKLERKISRFLWTNGLIYILYVNIFIVLVGSSILSVVEEKSFSDSLWWALVTVTTVGYGDIVPVSLFGKWLAVLLMLVGIGTIGVLTSALTNFFVKDNPDEQIKLDKLKDELSSQRILIEKQSEKIEELH GT:EXON 1|1-247:0| BL:SWS:NREP 1 BL:SWS:REP 36->244|KCNF1_MOUSE|3e-14|30.7|205/493| TM:NTM 6 TM:REGION 14->36| TM:REGION 39->61| TM:REGION 69->91| TM:REGION 133->155| TM:REGION 159->181| TM:REGION 189->211| SEG 15->28|iillalisvilvll| SEG 97->112|rltkltkllkltrllr| SEG 143->154|ivlvgssilsvv| BL:PDB:NREP 1 BL:PDB:REP 158->212|1zwiC|2e-13|47.3|55/103| RP:PDB:NREP 1 RP:PDB:REP 155->219|2atkC|7e-14|26.2|65/103| RP:PFM:NREP 1 RP:PFM:REP 158->211|PF07885|1e-06|38.9|54/81|Ion_trans_2| HM:PFM:NREP 3 HM:PFM:REP 141->212|PF07885|2.4e-19|36.1|72/79|Ion_trans_2| HM:PFM:REP 72->159|PF03268|0.00018|20.5|83/353|DUF267| HM:PFM:REP 191->243|PF06295|0.00039|25.0|52/128|DUF1043| RP:SCP:NREP 1 RP:SCP:REP 43->213|1orqC|4e-20|23.1|169/223|f.14.1.1| HM:SCP:REP 2->215|1orqC_|8.8e-38|29.9|214/223|f.14.1.1|1/1|Voltage-gated potassium channels| OP:NHOMO 130 OP:NHOMOORG 116 OP:PATTERN 11-------------------------------11----------------------------1---- ---------------------1--1------111111----------------1-------------12--1----11-------------1--11------1--11------------------------------11--1--------------------------------------------------1--------------------------------1111111---------------------111--1-11-21111--1-11--1---------------11111111--------------11---111--2-1---------------1-----------1-----------------1--------------11---------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------1-------1--------------------------------------------11--11-1--------------1----1---------------------------------------------------------------------------------------------------------------------------------------11111----1---------------2---1--------112211111121211-----------------------------------------------------------1------------1 ----------------------------------------------------------------------------------------------------------------1--1-------------------------------------------------115113--1-------1----------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 65 STR:RPRED 26.3 SQ:SECSTR ##########################################################################################################################################################ccccHHHHHHHHHHHHTTcccTTcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHT############################ DISOP:02AL 1-1,221-248| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHc //