[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56457.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  556/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
c.55.3
:139 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->136 1vhxB PDBj 1e-26 51.2 %
:RPS:PDB   59->123 2aazA PDBj 7e-04 18.6 %
:RPS:SCOP  1->137 1vhxA  c.55.3.8 * 2e-42 50.7 %
:HMM:SCOP  1->139 1nu0A_ c.55.3.8 * 2.9e-40 46.3 %
:RPS:PFM   2->136 PF03652 * UPF0081 5e-31 54.5 %
:HMM:PFM   1->137 PF03652 * UPF0081 4.3e-45 45.5 134/135  
:BLT:SWISS 1->139 RUVX_STRZT 3e-64 88.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56457.1 GT:GENE ACF56457.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 181669..182088 GB:FROM 181669 GB:TO 182088 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE identified by match to protein family HMM PF03652; match to protein family HMM TIGR00250 GB:PROTEIN_ID ACF56457.1 GB:DB_XREF GI:194358009 LENGTH 139 SQ:AASEQ MRIMGLDVGSKTVGVAISDPLGFTAQGXEIIQINEEQGQFGFDRVKELVDTYKVERFVVGLPKNMNNTSGPRVEASQAYGAKLEEFFGLPVDYQDERLTTVAAERMLIEQADISRNKRKKVIDKLAAQLILQNYLDRKF GT:EXON 1|1-139:0| BL:SWS:NREP 1 BL:SWS:REP 1->139|RUVX_STRZT|3e-64|88.5|139/139| SEG 26->41|qgxeiiqineeqgqfg| BL:PDB:NREP 1 BL:PDB:REP 1->136|1vhxB|1e-26|51.2|129/132| RP:PDB:NREP 1 RP:PDB:REP 59->123|2aazA|7e-04|18.6|59/305| RP:PFM:NREP 1 RP:PFM:REP 2->136|PF03652|5e-31|54.5|132/134|UPF0081| HM:PFM:NREP 1 HM:PFM:REP 1->137|PF03652|4.3e-45|45.5|134/135|UPF0081| GO:PFM:NREP 5 GO:PFM GO:0005737|"GO:cytoplasm"|PF03652|IPR005227| GO:PFM GO:0006281|"GO:DNA repair"|PF03652|IPR005227| GO:PFM GO:0006310|"GO:DNA recombination"|PF03652|IPR005227| GO:PFM GO:0006974|"GO:response to DNA damage stimulus"|PF03652|IPR005227| GO:PFM GO:0016788|"GO:hydrolase activity, acting on ester bonds"|PF03652|IPR005227| RP:SCP:NREP 1 RP:SCP:REP 1->137|1vhxA|2e-42|50.7|136/140|c.55.3.8| HM:SCP:REP 1->139|1nu0A_|2.9e-40|46.3|136/0|c.55.3.8|1/1|Ribonuclease H-like| OP:NHOMO 560 OP:NHOMOORG 559 OP:PATTERN -------------------------------------------------------------------- 111-----111-1--------1--1------11---11---11--1------1---------1---1--1-1---1111-11---11111111111----1-----11----------------1---------1--1111111111111111--11------1-111111-----------------11-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111--1---111111111111111111111111111111111-111111111111111111-111111-111111111111111111111-111-11111--------11----1--1-1--------111-1-----111111-----1111------111------1-1---------------11-111111111-11-11-----1----1-------------11111-1----------------------------111--1111111111111111111111111---1----1----1111-111111111111-1111111111111111111111111111111111111111111111111111-111111111111111-111111111---11111111111111--1---------1111111111111111-111---------1----------------------------1-------------------1111-1--1111--111-1-----------------111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--1-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 139 STR:RPRED 100.0 SQ:SECSTR cEEEEEEEcccEEEEEEEcTTcccEEEEEEEEccGGGTcccHHHHHHHTccccEEEEETTcTTccTTccccHHHHHHcHHHHHHcTcccccTTcccTTccccHHHHHHHHHHHcTTccccEEEHHHTHHHHHHHHTHTc DISOP:02AL 111-116| PSIPRED cEEEEEEccccEEEEEEEccccccccccEEEEEEcccccccHHHHHHHHHHHcccEEEEcccccccccccHHHHHHHHHHHHHHHHHcccEEEEcccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcc //