[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56458.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:Y1998_STRPI  RecName: Full=UPF0154 protein SPH_1998;

Homologs  Archaea  0/68 : Bacteria  42/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:82 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   17->71 PF03672 * UPF0154 5e-07 36.4 %
:HMM:PFM   9->71 PF03672 * UPF0154 1.2e-16 39.7 63/64  
:BLT:SWISS 14->71 Y1998_STRPI 6e-29 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56458.1 GT:GENE ACF56458.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1699329..1699577) GB:FROM 1699329 GB:TO 1699577 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF56458.1 GB:DB_XREF GI:194358010 LENGTH 82 SQ:AASEQ MDLLLAIVLIVLAFLGGALGGMYLVRKQIEKEFADNPRLNAEAVRTLLSANGQKPSEAKVQQVYHQIIRQQKAALANNKKKK GT:EXON 1|1-82:0| SW:ID Y1998_STRPI SW:DE RecName: Full=UPF0154 protein SPH_1998; SW:GN OrderedLocusNames=SPH_1998; SW:KW Cell membrane; Complete proteome; Membrane; Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 14->71|Y1998_STRPI|6e-29|100.0|58/82| GO:SWS:NREP 3 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 1 TM:REGION 4->25| SEG 3->13|lllaivlivla| SEG 72->81|kaalannkkk| RP:PFM:NREP 1 RP:PFM:REP 17->71|PF03672|5e-07|36.4|55/65|UPF0154| HM:PFM:NREP 1 HM:PFM:REP 9->71|PF03672|1.2e-16|39.7|63/64|UPF0154| OP:NHOMO 42 OP:NHOMOORG 42 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111--1111111111111111111111111111111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,48-83| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcc //