[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56467.1
DDBJ      :             ABC transporter, ATP-binding protein
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  908/915 : Eukaryota  197/199 : Viruses  1/175   --->[See Alignment]
c.37.1
:213 amino acids
:PSIPRED
:BLT:PDB   1->194 1l2tB PDBj 2e-29 36.6 %
:RPS:PDB   1->189 3c95A PDBj 1e-34 12.5 %
:RPS:SCOP  1->208 1b0uA  c.37.1.12 * 3e-38 28.4 %
:HMM:SCOP  4->209 1ii8.1 c.37.1.12 * 6.5e-60 36.1 %
:RPS:PFM   41->164 PF00005 * ABC_tran 6e-13 37.8 %
:HMM:PFM   41->164 PF00005 * ABC_tran 1.8e-24 37.6 117/118  
:HMM:PFM   13->58 PF03193 * DUF258 4.6e-07 31.1 45/161  
:BLT:SWISS 1->208 MACB_SYNFM 6e-33 41.3 %
:PROS 136->150|PS00211|ABC_TRANSPORTER_1

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56467.1 GT:GENE ACF56467.1 GT:PRODUCT ABC transporter, ATP-binding protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1800327..1800968) GB:FROM 1800327 GB:TO 1800968 GB:DIRECTION - GB:PRODUCT ABC transporter, ATP-binding protein GB:NOTE identified by match to protein family HMM PF00005; match to protein family HMM TIGR03608 GB:PROTEIN_ID ACF56467.1 GB:DB_XREF GI:194358019 LENGTH 213 SQ:AASEQ MIDIQGLEKKFNDRAIFSGLNLKLEKGKVYALIGKSGSGKTTLLNILGKLEKIDGGRVLYQGKDLKTIPTREYFRDQMGYLFQNFGLLENQSIKENLDLGFVGQKISKVERLERQVGALEKVNLGYLDLEQKIYTLSGGEAQRVALAKTILKNPPLILADEPTAALDPENSEEVMNLLVDLKDENRIIIIATHNPLVWNKAXEIIDMRKLAHV GT:EXON 1|1-213:0| BL:SWS:NREP 1 BL:SWS:REP 1->208|MACB_SYNFM|6e-33|41.3|206/715| PROS 136->150|PS00211|ABC_TRANSPORTER_1|PDOC00185| BL:PDB:NREP 1 BL:PDB:REP 1->194|1l2tB|2e-29|36.6|194/232| RP:PDB:NREP 1 RP:PDB:REP 1->189|3c95A|1e-34|12.5|184/446| RP:PFM:NREP 1 RP:PFM:REP 41->164|PF00005|6e-13|37.8|119/123|ABC_tran| HM:PFM:NREP 2 HM:PFM:REP 41->164|PF00005|1.8e-24|37.6|117/118|ABC_tran| HM:PFM:REP 13->58|PF03193|4.6e-07|31.1|45/161|DUF258| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 1->208|1b0uA|3e-38|28.4|208/258|c.37.1.12| HM:SCP:REP 4->209|1ii8.1|6.5e-60|36.1|205/370|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 52373 OP:NHOMOORG 1174 OP:PATTERN TTNARNIFUTTPUOWQlIQPINOavPTijWgUKDFEFDJIJHEVXUVlNR**j8SeQVWOROIDZ1C9 VcrO*ccesstXdRZRQPP-PkBBX*PPPPPOsnnot***R*W*q*sfricQ***NQiBBsr*j*o****ebZZZ*fcgR*hiDCFCEYYXT8VILO--IKZPRShSdLb9998889BDDAAAAKUQMVYRQWVbViut**ONN*ZvlqveemXcTUOMPLPJkgao***gJRJNKKKPHLKIhZdROtmCXjy************************hr***qp***yx***cnoqnqmlnooonnnfkejh*rdk**jRnfx**UV**caUdqpkjmuuyzur**zzvyvvtrx*swufdedcfihifede*rqihjtsvqv***********p*t****hmni**l***vwQM**ypagktUbngwtQegfQfXVVLOQNMRdV***eTy****************-qu*nn*x***TD**************LLN**********XWXXXXXX*bhKUpY*6678899966ABCCFHBCFECBCCB98B7LFGFFG***************w********j********ES**x*i*qv******dttQaNUnZKMLKMKKVVUcxnj**SkU*qajvdckMceZXXXlWZccTdx*a*SPOTIPPRRQJCEGGEGGGFJaHIMPOvuxU*ZjQZR*VbefbSZhcZZYabfdbef6-ELTRO321444****b**********y*-**x**********xyzxxz*****sulntlmoooooolmomml*tpqwwwwX5************45MLFJEFHRSUSSQ*s*deddeaOTWRQXTYjPRTSRIVKQVsiz*wx****y****k***IJJHIKJIJOmut*uvvvv*****TTPPMQPLNODDDDA8NYaZPPPQAA9BB9BA*EdFCDDH-GFFDHCDTSPDEPBJF888gruYZo*rssHdO 2344pkH-THB8PdQGENIFOSNVMXOGFDFDFMKKEMGIHHHFEEGEKQTNeSLMJ9FFFFB8F6973AA6BBG8A28AAFEDFL48-DK8EFFGACAEA4GQJJ9UZnhWZVlhhIECBEWMurBxA**n3lQqMEFBgGMcXBOFF7ZDA*GVQQ*Fb*KqNkC*Zd*afYPHIED*GIGERxdi*L*uKLzn*rO ------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------ PSIPRED cEEEEEEEEEEccEEEEEccEEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEcccccHHHHHHHHccEEEEcccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHcccHHHccccHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEcccHHHHHHccEEEEEEccEEc //