[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56471.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  32/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:234 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   19->160 1b0hA PDBj 1e-06 29.6 %
:RPS:PDB   11->68 1b0hA PDBj 2e-04 17.2 %
:RPS:PDB   60->160 2d5wA PDBj 2e-05 19.2 %
:RPS:SCOP  11->68 1b05A  c.94.1.1 * 8e-05 17.2 %
:RPS:SCOP  60->160 1uqwA  c.94.1.1 * 3e-06 16.5 %
:HMM:SCOP  70->174 1jetA_ c.94.1.1 * 3.6e-06 28.9 %
:HMM:PFM   67->100 PF00496 * SBP_bac_5 0.0001 35.3 34/372  
:BLT:SWISS 35->234 SARA_STRGC 8e-37 39.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56471.1 GT:GENE ACF56471.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 754456..755160 GB:FROM 754456 GB:TO 755160 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE identified by glimmer; putative GB:PROTEIN_ID ACF56471.1 GB:DB_XREF GI:194358023 LENGTH 234 SQ:AASEQ MVLSTLAILVACGKTDKEADAPTTFSYVYAVDPASLGYSIATRTSTTDVIGNVIDGLMENDKYGNVAPSQKDYDLNSTGWAPSYQDPASYLNIMDPKSGSAMKHLGITKGKDKDVVAKPGLDKYKKLLEDAVSETTDLEKRYEKYAKAQAWSTDSSLLMPTASSGGSPVVSNVVPFSKPYSQVGIKGEPYIFKGMKLQKDIVTTKEYNEVFKKWQKEKLESNSKYQKELEKYIK GT:EXON 1|1-234:0| BL:SWS:NREP 1 BL:SWS:REP 35->234|SARA_STRGC|8e-37|39.9|198/663| SEG 163->175|ssggspvvsnvvp| BL:PDB:NREP 1 BL:PDB:REP 19->160|1b0hA|1e-06|29.6|125/517| RP:PDB:NREP 2 RP:PDB:REP 11->68|1b0hA|2e-04|17.2|58/517| RP:PDB:REP 60->160|2d5wA|2e-05|19.2|99/602| HM:PFM:NREP 1 HM:PFM:REP 67->100|PF00496|0.0001|35.3|34/372|SBP_bac_5| RP:SCP:NREP 2 RP:SCP:REP 11->68|1b05A|8e-05|17.2|58/517|c.94.1.1| RP:SCP:REP 60->160|1uqwA|3e-06|16.5|91/487|c.94.1.1| HM:SCP:REP 70->174|1jetA_|3.6e-06|28.9|90/0|c.94.1.1|2/2|Periplasmic binding protein-like II| OP:NHOMO 78 OP:NHOMOORG 32 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11114--34444444444-1111111111115--442-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 150 STR:RPRED 64.1 SQ:SECSTR ##########ccccTTcccccccEEEEEcccccccccTTccccHHHHHHHHHHccccEEcHHHHTcGGGTccccEEEEEEEcccccccGGGccccTTTccccccccGGGTTccccTTccccHHHHHHHHHHTTcGccHHHHHHHHHHHHHHHHHHccEEE########################################################################## DISOP:02AL 14-19,21-21,214-228,233-235| PSIPRED cHHHHHHHHHHHccccccccccEEEEEEEEEcHHHHHHHHHHcccccccEEccEEEEEcccccccccHHHccccEEcccccccHHcHHHHHHHHcccccccEEEccccccccHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccHHHccccccEEEEEcccccccccccccccccccccEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //