[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56473.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:72 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   15->45 PF11732 * Thoc2 0.00013 32.3 31/77  
:HMM:PFM   37->70 PF08031 * BBE 0.00012 31.6 19/47  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56473.1 GT:GENE ACF56473.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(414900..415118) GB:FROM 414900 GB:TO 415118 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF56473.1 GB:DB_XREF GI:194358025 LENGTH 72 SQ:AASEQ MMSIREQDLKDIGAIIKYKNFHSPFDTFKYLKDMGFDTIDLSVLLEXFSYAYGMDWLEKFFKENQDKLREFY GT:EXON 1|1-72:0| HM:PFM:NREP 2 HM:PFM:REP 15->45|PF11732|0.00013|32.3|31/77|Thoc2| HM:PFM:REP 37->70|PF08031|0.00012|31.6|19/47|BBE| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-11-11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7,68-70| PSIPRED cccHHHHHHHHHHHHHHHHccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc //