[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56475.1
DDBJ      :             TPP-dependent acetoin dehydrogenase alpha-subunit
Swiss-Prot:             

Homologs  Archaea  23/68 : Bacteria  592/915 : Eukaryota  192/199 : Viruses  0/175   --->[See Alignment]
c.36.1
:322 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->321 3exeE PDBj 5e-50 40.3 %
:RPS:PDB   4->322 3dvaA PDBj 6e-49 26.0 %
:RPS:SCOP  1->322 1ni4A  c.36.1.11 * 2e-51 30.3 %
:HMM:SCOP  2->322 1dtwA_ c.36.1.11 * 2.8e-106 42.4 %
:RPS:PFM   17->307 PF00676 * E1_dh 3e-46 37.4 %
:HMM:PFM   14->311 PF00676 * E1_dh 8.8e-92 44.0 293/300  
:BLT:SWISS 4->322 ODPA_PORPU 2e-55 36.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56475.1 GT:GENE ACF56475.1 GT:PRODUCT TPP-dependent acetoin dehydrogenase alpha-subunit GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1041674..1042642) GB:FROM 1041674 GB:TO 1042642 GB:DIRECTION - GB:PRODUCT TPP-dependent acetoin dehydrogenase alpha-subunit GB:NOTE identified by match to protein family HMM PF00676 GB:PROTEIN_ID ACF56475.1 GB:DB_XREF GI:194358027 LENGTH 322 SQ:AASEQ MSTLDKNLLLEMFRKMEEIRRMDLKIAQLVKKGKVPGMTHFSVGEEAANVGAMLALNPDDLITSNHRGHGQAIAKGIDLNGMMAEILGKYTGTCKGKGGSMHIADLDAGNLGANGIVGGGMGIAVGAALSQQMQNTGKIVVCFFGDGATNEGVFHEAVNMASIWNLPVIFYCINNGYGISADIKKMTNIEHIHQRSAAYGIPGMFIEDGNNVIDVYEGFQKAVDHVRSGNGPVLIESVTYRWLGHSSSDPGKYRTREEVELWKQKDPIENLRNYLIENNIASAEELEEIQAQVKEAVEASVKFAEESPFPPLESAFEDIYAD GT:EXON 1|1-322:0| BL:SWS:NREP 1 BL:SWS:REP 4->322|ODPA_PORPU|2e-55|36.2|318/344| SEG 88->99|gkytgtckgkgg| SEG 108->129|agnlgangivgggmgiavgaal| BL:PDB:NREP 1 BL:PDB:REP 10->321|3exeE|5e-50|40.3|305/361| RP:PDB:NREP 1 RP:PDB:REP 4->322|3dvaA|6e-49|26.0|308/365| RP:PFM:NREP 1 RP:PFM:REP 17->307|PF00676|3e-46|37.4|289/298|E1_dh| HM:PFM:NREP 1 HM:PFM:REP 14->311|PF00676|8.8e-92|44.0|293/300|E1_dh| GO:PFM:NREP 2 GO:PFM GO:0008152|"GO:metabolic process"|PF00676|IPR001017| GO:PFM GO:0016624|"GO:oxidoreductase activity, acting on the aldehyde or oxo group of donors, disulfide as acceptor"|PF00676|IPR001017| RP:SCP:NREP 1 RP:SCP:REP 1->322|1ni4A|2e-51|30.3|317/362|c.36.1.11| HM:SCP:REP 2->322|1dtwA_|2.8e-106|42.4|316/394|c.36.1.11|1/1|Thiamin diphosphate-binding fold (THDP-binding)| OP:NHOMO 1604 OP:NHOMOORG 807 OP:PATTERN 11----1-2121222---111---3221--22----------------------------2111---- 11213-------1-22222-2---32222221322214533435122211113352241143312272322-----------5---1-111--1--21122223343132222222222222221---------2-45522---2311111111111111111111311212111211211112212211-323333333332333333353343333355233222222242122222222222222233322-1-22-1---111111111111111111111112211111-111111111111111111211111111111---1111111-1-1111---------3------1-------21213-13--411411111222112112112144443343343-11111211231122212163224323212325121112322222222133112111111111111--11111111111111111-25B21-1-112222321111111141111-32122221--111-1-----2421---1----1----------1211-2-2----1-----212-23312221223-2----------------------1112211-11-221122211122111112111123---21--------------1-------------------------------11--12------------------------------------------2222222222--2-1---------------11111-1---3-3333121112221-----------------1-----11-111111111111---------11111----------111111-1-11111111111111-------------121 22--222-622-22222222333333322222222222222122221223223211222222211111111111111-1111111111-2322222222222222412924533331221233333273AT3-7362221332312232342222122234223323645624223332T2224574762653432223 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 322 STR:RPRED 100.0 SQ:SECSTR cccccHHHHHHHHHHHHHHHHHHHHHHHHHHTTcccccccccTTcHHHHHHHHTTccTTcEEEccTTcHHHHHHTTccHHHHHHHHHTcGGGGcccTTccccccccTTTcccccccTTHHHHHHHHHHHHHHHHTccccEEEEEETGGGGcHHHHHHHHHHHHTTccEEEEEEEccEETTEEGGGTccccccGGGGGGTTccEEEEEETTcHHHHHHHHHHHHHHHHTTcccEEEEEEccccccccTTcTTccccccTTGGGccccHHHHHHHHHHTTTcccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHTTccc DISOP:02AL 1-1| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHcccccEEEcccccHHHHHHHcccHHHHHHHHHHHccccccccccccccccccccEEccccccccHHHHHHHHHHHHHHcccccEEEEEEEcHHHHHHHHHHHHHHHHHccccEEEEEEcccccccccHHHHcccccHHHHHHHHcccEEEEcccccHHHHHHHHHHHHHHHHHccccEEEEEEcccEEccccccccccccHHHHHHHHHcccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHccc //