[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56476.1
DDBJ      :             PTS system, IIA component
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  207/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.7.2
:105 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->102 1e2aA PDBj 9e-41 75.5 %
:RPS:PDB   1->102 1e2aA PDBj 9e-30 75.5 %
:RPS:SCOP  1->102 1e2aA  a.7.2.1 * 9e-30 75.5 %
:HMM:SCOP  1->102 1e2aA_ a.7.2.1 * 7.4e-35 54.9 %
:RPS:PFM   12->102 PF02255 * PTS_IIA 7e-16 50.5 %
:HMM:PFM   10->102 PF02255 * PTS_IIA 3.9e-38 58.1 93/96  
:BLT:SWISS 1->105 PTLA_LACLA 1e-41 75.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56476.1 GT:GENE ACF56476.1 GT:PRODUCT PTS system, IIA component GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1062980..1063297) GB:FROM 1062980 GB:TO 1063297 GB:DIRECTION - GB:PRODUCT PTS system, IIA component GB:NOTE identified by match to protein family HMM PF02255; match to protein family HMM TIGR00823 GB:PROTEIN_ID ACF56476.1 GB:DB_XREF GI:194358028 LENGTH 105 SQ:AASEQ MNREEVTLLGFEIVAYAGDARSKLLEALKAAEAGDFEKADALVEEAGSCIAEAHHAQTSLLTKEASGEDLAYSVTMMHGQDHLMTTILLKDLMHHLIELYKRGVK GT:EXON 1|1-105:0| BL:SWS:NREP 1 BL:SWS:REP 1->105|PTLA_LACLA|1e-41|75.2|105/105| SEG 23->33|kllealkaaea| BL:PDB:NREP 1 BL:PDB:REP 1->102|1e2aA|9e-41|75.5|102/102| RP:PDB:NREP 1 RP:PDB:REP 1->102|1e2aA|9e-30|75.5|102/102| RP:PFM:NREP 1 RP:PFM:REP 12->102|PF02255|7e-16|50.5|91/96|PTS_IIA| HM:PFM:NREP 1 HM:PFM:REP 10->102|PF02255|3.9e-38|58.1|93/96|PTS_IIA| GO:PFM:NREP 4 GO:PFM GO:0005351|"GO:sugar:hydrogen symporter activity"|PF02255|IPR003188| GO:PFM GO:0006810|"GO:transport"|PF02255|IPR003188| GO:PFM GO:0009401|"GO:phosphoenolpyruvate-dependent sugar phosphotransferase system"|PF02255|IPR003188| GO:PFM GO:0016020|"GO:membrane"|PF02255|IPR003188| RP:SCP:NREP 1 RP:SCP:REP 1->102|1e2aA|9e-30|75.5|102/102|a.7.2.1| HM:SCP:REP 1->102|1e2aA_|7.4e-35|54.9|102/0|a.7.2.1|1/1|Enzyme IIa from lactose specific PTS, IIa-lac| OP:NHOMO 402 OP:NHOMOORG 207 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------3333333332324233322232333-1112-25564441--111111111111111112111--35--3-121--561-2113-1-1121323322555545645442222222222222312---3224-2-281111111211-4---112--------------------111---2------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11----------------------------------------12-1-2-111111111--111111111111111111234322111----------------2---1111--3111111-1111------------------------------------------------------------------------21111111111-11-----------------1----------1-------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 103 STR:RPRED 98.1 SQ:SECSTR ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHTcH## DISOP:02AL 1-1,105-106| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //