[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56479.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  39/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.356.1
:180 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->179 2hiyD PDBj 5e-95 96.0 %
:RPS:SCOP  2->180 2hiyA1  d.356.1.1 * 1e-65 96.6 %
:RPS:PFM   1->131 PF08002 * DUF1697 4e-19 40.0 %
:HMM:PFM   1->132 PF08002 * DUF1697 6.9e-35 38.9 131/137  
:BLT:SWISS 71->178 YCF2_CYCTA 5e-04 29.1 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56479.1 GT:GENE ACF56479.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 731091..731633 GB:FROM 731091 GB:TO 731633 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE identified by match to protein family HMM PF08002 GB:PROTEIN_ID ACF56479.1 GB:DB_XREF GI:194358031 LENGTH 180 SQ:AASEQ MTRYALLVRGINVGSKNKVVMAELHQELTNLGLEKVESYINSGNIFFASIDSKAQLVEKLETFFAVHYPFIQSFSVLSLEDFEAELENLPAWWSRDLARKDFLFYTEGLDVDQVIATVESLELKDEVLYFGKLGIFWGKFSEESYSKTAYQKYLLKVPFYRHITIRNAKTFDKIGQMLKK GT:EXON 1|1-180:0| BL:SWS:NREP 1 BL:SWS:REP 71->178|YCF2_CYCTA|5e-04|29.1|103/100| BL:PDB:NREP 1 BL:PDB:REP 2->179|2hiyD|5e-95|96.0|177/180| RP:PFM:NREP 1 RP:PFM:REP 1->131|PF08002|4e-19|40.0|130/136|DUF1697| HM:PFM:NREP 1 HM:PFM:REP 1->132|PF08002|6.9e-35|38.9|131/137|DUF1697| RP:SCP:NREP 1 RP:SCP:REP 2->180|2hiyA1|1e-65|96.6|178/179|d.356.1.1| OP:NHOMO 41 OP:NHOMOORG 39 OP:PATTERN -------------------------------------------------------------------- ---------------------1----------1----1---------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------1----------1-------------------------------------1---------------11111-21121111-------------1--11------11-------------111----1---------111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----11-1------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 177 STR:RPRED 98.3 SQ:SECSTR #EEEEEEccccccTTccccc#HHHHHHHHHHTcEEEEEcccccEEEEEEcccHHHHHHHHHHHHHHHcTTccccEEEEHHHHHHHHTTccGGGGccccEEEEEEEcTTccHHHHHHHHHTcccccEEEEEcccEEEEEEccTTTGGGcHHHHHGGGcTTGGGEEEEEHHHHHHHHHHHc# DISOP:02AL 1-1,180-181| PSIPRED ccEEEEEEEEEEEcccccccHHHHHHHHHHccHHHHHHHHccccEEEEccccHHHHHHHHHHHHHHHccccccEEEEcHHHHHHHHHccccHHcccccEEEEEEEcccccHHHHHHHHccccccccEEEEcccEEEEEEEccccccHHHHHHHHcccccccccEEEEHHHHHHHHHHHcc //