[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56488.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:Y034_STRPN   RecName: Full=UPF0324 membrane protein SP_0034;

Homologs  Archaea  2/68 : Bacteria  394/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
:336 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   10->315 PF03601 * Cons_hypoth698 2e-38 42.4 %
:HMM:PFM   10->314 PF03601 * Cons_hypoth698 4.2e-100 42.3 298/305  
:BLT:SWISS 1->336 Y034_STRPN e-165 98.5 %
:PROS 83->97|PS00211|ABC_TRANSPORTER_1
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56488.1 GT:GENE ACF56488.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(33816..34826) GB:FROM 33816 GB:TO 34826 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE identified by match to protein family HMM PF03601 GB:PROTEIN_ID ACF56488.1 GB:DB_XREF GI:194358040 LENGTH 336 SQ:AASEQ MSFLSKNGAGILACLLISIVSWYLGGFXPVIGAPVFAIFIGMLLHPFLSSYKQLDAGLTFSSKKLLQYAVVLLGFGLNISQVFAVGQSSLPVILSTISIALIIAYLFQRFFALDTKLATLVGVXSSICGGSAIAATAPVIDAKEKEVAQAISVIFFFNVLAALIFPTLGTWLHLSNEGFALFAGTAVNDTSSVTAAASAWDSLYQSNTLXSATIVKLTRTLAIIPITLFLSYWQSRQQENKQSLQLKKVFPLFILYFILASLLTTLLTSLGVSSSFFTPLKELSKFLIVMAMSAIGLKTNLVAMVKSSGKSILLGAICWIAIILTTLGMQTLIGIF GT:EXON 1|1-336:0| SW:ID Y034_STRPN SW:DE RecName: Full=UPF0324 membrane protein SP_0034; SW:GN OrderedLocusNames=SP_0034; SW:KW Cell membrane; Complete proteome; Membrane; Transmembrane. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->336|Y034_STRPN|e-165|98.5|336/336| GO:SWS:NREP 3 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| PROS 83->97|PS00211|ABC_TRANSPORTER_1|PDOC00185| TM:NTM 10 TM:REGION 2->24| TM:REGION 28->50| TM:REGION 65->87| TM:REGION 92->114| TM:REGION 119->140| TM:REGION 148->170| TM:REGION 209->230| TM:REGION 251->273| TM:REGION 283->305| TM:REGION 312->334| SEG 93->104|ilstisialiia| SEG 261->275|sllttlltslgvsss| RP:PFM:NREP 1 RP:PFM:REP 10->315|PF03601|2e-38|42.4|297/303|Cons_hypoth698| HM:PFM:NREP 1 HM:PFM:REP 10->314|PF03601|4.2e-100|42.3|298/305|Cons_hypoth698| GO:PFM:NREP 1 GO:PFM GO:0016021|"GO:integral to membrane"|PF03601|IPR018383| OP:NHOMO 416 OP:NHOMOORG 401 OP:PATTERN ----------------------------1-1------------------------------------- 121-----------111-------------------1--------1------1------------------1111111--1----1112221-111-----2---21--2---------------111--1--11----------------------------------------------------------1111111111111111------11111-1---1111111-1---1-----------11-11-11--111-111----1-111-11111111111111111111111111111111111111111111111-11-111111111111111111-11-21-----11-1--1111-----1----1----11-1--111---1111111111111111-112-131111---111---11--113---1-11-1111----------111---1-----------------------------1-11--1111--1111---------1----------1-1-------1----2-----------1--11-1-------1----------111----111-1111-11---1-11-1111---1-------11111----1-1-1-211-11111-111111111111-------------1111-1-1111111-11-111111111111111111----11111111111111111111111111111---11111111111---1-----------11--------1111-111-------111-----1-----111-----1-1-1111--1111-----11111----1--111------------------------1------------------------------------11 ------1-----------------------------------------------------------------------------------------------------1----------------------------------------------------------------------1------------11----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,4-4,234-250| PSIPRED cHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHccc //