[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56497.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  16/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:331 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   149->174 PF09339 * HTH_IclR 8.8e-06 42.3 26/52  
:HMM:PFM   273->317 PF09952 * DUF2186 0.00064 25.6 39/143  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56497.1 GT:GENE ACF56497.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1755255..1756250) GB:FROM 1755255 GB:TO 1756250 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF56497.1 GB:DB_XREF GI:194358049 LENGTH 331 SQ:AASEQ MNVKKIMSIFQSFYVDVSIEELTLTLPISFVKRFEYTQMTFHKESFLLIKEKRRGSLSSFVTQARTMGEKANMDVVLVFSKLSDSEKKQLLQARVPFVDFKGNLFFPPLGLVLNANDTEVPKELTPSEQLTWIAFLLTKGQKVVDVDLLSQVTGLPNSTIYRCLRTFKALYWLNKQNKLYTYTVSKKELFLKSVSCLFNPIKKRILLPDGDIKQIKSVSNLLYGGAYALSHSTFLAETDENIXXVIWQRKFNQLSLPLSQHVLKGKMLEIWKYRPFVSEFWNDFKNNHDKQFVDPISLYLTLKDDDDPRIEEESEALENMILQYLGEDDAS GT:EXON 1|1-331:0| HM:PFM:NREP 2 HM:PFM:REP 149->174|PF09339|8.8e-06|42.3|26/52|HTH_IclR| HM:PFM:REP 273->317|PF09952|0.00064|25.6|39/143|DUF2186| OP:NHOMO 25 OP:NHOMOORG 16 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------1----------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------22221122212-----------------------------------------------------2-----1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,328-332| PSIPRED ccHHHHHHHHHHHEEEEEEEEEEEEccHHHHHHccccEEEEEccEEEEEEHHccccHHHHHHHHHHHcHHcccEEEEEEcccccHHHHHHHHcccccEEEcccEEEccccEEEEEcccHHHHHccHHHHHHHHHHHHccccEEEEEEHHHHHcccccHHHHHHHHHHHHHHHcccccEEEEEEEcHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHHHHHHEEEEEcccccHHHHHHHHHccEEcccccHHcccccEEEEEEccHHHHHHHHHHHccccccccccEEEEEEEEccccHHHHHHHHHHHHHHHHHHcccccc //