[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56498.1
DDBJ      :             cysteine desulfurase, SufS subfamily protein
Swiss-Prot:             

Homologs  Archaea  48/68 : Bacteria  904/915 : Eukaryota  193/199 : Viruses  0/175   --->[See Alignment]
c.67.1
:408 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->399 1i29A PDBj e-106 47.5 %
:RPS:PDB   3->399 3caiA PDBj 1e-49 20.9 %
:RPS:SCOP  11->398 1elqA  c.67.1.3 * 3e-90 23.1 %
:HMM:SCOP  2->402 1c0nA_ c.67.1.3 * 5e-132 41.2 %
:RPS:PFM   24->393 PF00266 * Aminotran_5 4e-79 44.4 %
:HMM:PFM   24->393 PF00266 * Aminotran_5 2.2e-150 48.6 370/371  
:BLT:SWISS 2->408 CSD_BACHD e-140 57.9 %
:PROS 214->233|PS00595|AA_TRANSFER_CLASS_5

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56498.1 GT:GENE ACF56498.1 GT:PRODUCT cysteine desulfurase, SufS subfamily protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 765655..766881 GB:FROM 765655 GB:TO 766881 GB:DIRECTION + GB:PRODUCT cysteine desulfurase, SufS subfamily protein GB:NOTE identified by match to protein family HMM PF00266; match to protein family HMM PF01212; match to protein family HMM TIGR01979 GB:PROTEIN_ID ACF56498.1 GB:DB_XREF GI:194358050 LENGTH 408 SQ:AASEQ MLDVEAIRKDFPILDQIVNDEPLVYLDNAATTQKPLVVLKAINSYYEQDNANVHRGVHTLAERATASYEAARETIRKFINAGSTKEVLFTRGTTTSLNWVARFAEEILTEGDQVLISVMEHHSNIIPWQEACRKTGAELVYVYLKDGALDMEDLRAKLTDKVKFVSLAHASNVLGVVNPIKEITQLAHQVGAIMVVDGAQSTPHMKIDVQDLDLDFFAFSGHKMAGPTGIGVLYGKXKYLEQMSPVXFGGEMIDFVYEQSASWXELPWKFEAGTPNMAGAIGLATAVDYLEKIGMDAVEAHEQELIAYVYPKLQAIEGLTIYGSQDLAQRSGVIAFNLGDLHPHDLATALDYEGVAVRAGHHCAQPLLQYLEVPALARASFYIYNTKADCDKLVDALQKTKEFFNGTF GT:EXON 1|1-408:0| BL:SWS:NREP 1 BL:SWS:REP 2->408|CSD_BACHD|e-140|57.9|404/406| PROS 214->233|PS00595|AA_TRANSFER_CLASS_5|PDOC00514| BL:PDB:NREP 1 BL:PDB:REP 1->399|1i29A|e-106|47.5|396/405| RP:PDB:NREP 1 RP:PDB:REP 3->399|3caiA|1e-49|20.9|388/396| RP:PFM:NREP 1 RP:PFM:REP 24->393|PF00266|4e-79|44.4|358/359|Aminotran_5| HM:PFM:NREP 1 HM:PFM:REP 24->393|PF00266|2.2e-150|48.6|370/371|Aminotran_5| GO:PFM:NREP 1 GO:PFM GO:0008152|"GO:metabolic process"|PF00266|IPR000192| RP:SCP:NREP 1 RP:SCP:REP 11->398|1elqA|3e-90|23.1|364/381|c.67.1.3| HM:SCP:REP 2->402|1c0nA_|5e-132|41.2|398/0|c.67.1.3|1/1|PLP-dependent transferases| OP:NHOMO 3111 OP:NHOMOORG 1145 OP:PATTERN 111-2-11111111111------221112222111-------15624512553112-1111---3-43 3471412122221163333-33333533333333335544124333213113434-13--6352745534211112224343521221111111222212283465365411111111111111211111211121555441-15646565553345333343454386764344444344443121121124544444445544444454552544455543244444434433333333333333343333422323332333333333331113233333333333333333333333333333333333333333333327456444445444534552444833445432155433233246542122716322212122426342213433411111111122133333332442222223343244333433113342253333333333144334332222222222-111112111111112222121213122222344434444422114443235352342112222212223223312323431111111113222343222111113111113633445623444443433122222212232222222221-1343333232245343333333333233442232-2332311111133432333333333333-33333333333333333333534467333323333333333235333233332344454444454222233333222243325222222223222222222321211173443446453444544442222222221333433333434332213122111111111322222221111111141111111-1111111111111121111-221122222511 2222236-5211-212222134244522222221121111111222222253332222211111111111111111111111111111-33223221111132111123662322321232222222318K2-22221-131222121-121121222221117531111E32732324n33333437612D2374886 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 408 STR:RPRED 100.0 SQ:SECSTR cccHHHHHHTcTTTTccTTccccEEccGGGcccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHTccGGGGEEEEccHHHHHHHHHHHTGGGGcTTcEEEEETTccGGGTHHHHHHHHHHccEEEEEcccTccccGGGHHHHccTTEEEEEEEcccTTTccccccHHHHHHHHHTTcEEEEEcTTTTTTccccHHHHcccEEEEEGGGGTccccEEEEEccHHHHHTcccccccTTccGGGGGccccccHHHHHHHHHHHHHTccTTccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHTcTTEEEccccccHccccEEEEEETTccHHHHHHHHHHTTEEcEEcccHHHHHHTTTTTTccEEEEccTTccHHHHHHHHHHHHTTTcccHHEE PSIPRED cccHHHHHHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHcccccccEEEEcccHHHHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHHHcccEEEEEEcccccccHHHHHHHcccccEEEEEEcccccccEEccHHHHHHHHHHcccEEEEEcccccccccccHHHccccEEEEEcHHHcccccEEEEEEEcHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccccEEEEcccccHHcccEEEEEEccccHHHHHHHHHHccEEEEEccccccHHHHHcccccEEEEEccccccHHHHHHHHHHHHHHHHHHcccc //