[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56503.1
DDBJ      :             Tn5251 hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  31/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:165 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->165 2w82A PDBj 2e-85 100.0 %
:RPS:PFM   6->159 PF07275 * ArdA 5e-30 55.8 %
:HMM:PFM   5->162 PF07275 * ArdA 3.8e-56 50.0 158/169  
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56503.1 GT:GENE ACF56503.1 GT:PRODUCT Tn5251 hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1201735..1202232) GB:FROM 1201735 GB:TO 1202232 GB:DIRECTION - GB:PRODUCT Tn5251 hypothetical protein GB:NOTE identified by match to protein family HMM PF07275 GB:PROTEIN_ID ACF56503.1 GB:DB_XREF GI:194358055 LENGTH 165 SQ:AASEQ MDDMQVYIANLGKYNEGELVGAWFTFPIDFEEVKEKIGLNDEYEEYAIHDYELPFTVDEYTSIGELNRLWEMVSELPEELQSELSALLTHFSSIEELSEHQEDIIIHSDCDDMYDVARYYIEETGALGEVPASLQNYIDYQAYGRDLDLSGTFISTNHGIFEIVY GT:EXON 1|1-165:0| SEG 74->88|selpeelqselsall| BL:PDB:NREP 1 BL:PDB:REP 3->165|2w82A|2e-85|100.0|163/163| RP:PFM:NREP 1 RP:PFM:REP 6->159|PF07275|5e-30|55.8|154/167|ArdA| HM:PFM:NREP 1 HM:PFM:REP 5->162|PF07275|3.8e-56|50.0|158/169|ArdA| OP:NHOMO 39 OP:NHOMOORG 31 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------1-1---1----------1-------2-------------------1----11------------111-11-1--------------11---2-1-----------------611-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------1-----------------21-1--1-1---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 163 STR:RPRED 98.8 SQ:SECSTR ##ccEEEEEEEEEEccccEEEEEEEccccHHHHHHHHTccTTcccEEEEEEEccccccTTccHHHHHHHHHHHHHccHHHHTTHHHHTTTcccHHHHHHTGGGEEEETTcccHHHHHHHHHHTTcTTccccTGGGGGccHHHHHHHHHHHcEEEEETTEEEEEcc DISOP:02AL 1-1| PSIPRED cccHHHHHHHHHHHHcEEEEEEEEcccccHHHHHHHcccccccccHHHccccccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccHHcccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccEEcccEEEEccEEEEEEc //