[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56507.1
DDBJ      :             ABC transporter, permease protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  219/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:288 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->219 PF02653 * BPD_transp_2 3e-10 28.3 %
:HMM:PFM   2->269 PF02653 * BPD_transp_2 1.2e-30 27.4 259/267  
:BLT:SWISS 1->205 Y368_RICPR 2e-14 26.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56507.1 GT:GENE ACF56507.1 GT:PRODUCT ABC transporter, permease protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 953305..954171 GB:FROM 953305 GB:TO 954171 GB:DIRECTION + GB:PRODUCT ABC transporter, permease protein GB:NOTE identified by match to protein family HMM PF02653 GB:PROTEIN_ID ACF56507.1 GB:DB_XREF GI:194358059 LENGTH 288 SQ:AASEQ MIVSIISQGFVWAILGLGIFMTFRILNFPXMTTEGSFPLGGAVAVTLITKGVNPFLATLVAVGAGCLAGMAAGLLYTKGKIPTLLSGILVMTSCHSIMLLIMGRANLGLLGTKQIQDVLPFDSDLNQLLTGLIFVSIVIALMLFFLDTKLGQAYIATGDNPDMARSFGIHTGRMELMGLVLSNGVIALAGALIAQQEGYADVSRGIGVIVVGLASLIIGEVIFKSLSLAERLVTIVVGSIAYQFLVWAVIALGFNTSYLRLYSALILAVCLMIPTFKQTILKGAKLSK GT:EXON 1|1-288:0| BL:SWS:NREP 1 BL:SWS:REP 1->205|Y368_RICPR|2e-14|26.5|200/280| TM:NTM 8 TM:REGION 6->28| TM:REGION 46->68| TM:REGION 83->104| TM:REGION 127->149| TM:REGION 174->196| TM:REGION 202->224| TM:REGION 229->251| TM:REGION 256->278| SEG 56->75|latlvavgagclagmaagll| RP:PFM:NREP 1 RP:PFM:REP 1->219|PF02653|3e-10|28.3|219/271|BPD_transp_2| HM:PFM:NREP 1 HM:PFM:REP 2->269|PF02653|1.2e-30|27.4|259/267|BPD_transp_2| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF02653|IPR001851| GO:PFM GO:0006810|"GO:transport"|PF02653|IPR001851| GO:PFM GO:0016020|"GO:membrane"|PF02653|IPR001851| OP:NHOMO 268 OP:NHOMOORG 220 OP:PATTERN -------------------------------------------------------------------- -----1-1111--------------------------------------------11-----------------------------------------------------------------------------1---------------------------------------------------------1----------------1--------1221---------11--------------------112122-1111221122111111---22213222111111111212111111112111111322222222--1-12222222-21-2111------1-1-2--33-3111--------11-------111-1-------------11111111111---------11--111-11-11111------------------------------1------------1111-11--1111----------111-1-1111--1111111-1111111-21121--1111-1111-------------1-----------1---1-111---1---11-1--1----------1-------------------------------1-----1----------------------------------------------------------------------------------------------------------------------------------1-------------1----------111--1111--------------------------11111111-11-----------------1-------------------------------------------11---1----1- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 284-289| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHccHHHcHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHEEccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEcccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc //