[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56516.1
DDBJ      :             oxidoreductase, short chain dehydrogenase/reductase family protein
Swiss-Prot:             

Homologs  Archaea  33/68 : Bacteria  803/915 : Eukaryota  184/199 : Viruses  0/175   --->[See Alignment]
c.2.1
:253 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->237 1xg5C PDBj 2e-21 30.9 %
:RPS:PDB   3->230 1a27A PDBj 8e-29 22.2 %
:RPS:SCOP  3->242 1xg5A  c.2.1.2 * 2e-30 30.5 %
:HMM:SCOP  1->244 1zemA1 c.2.1.2 * 6.1e-57 36.1 %
:RPS:PFM   7->139 PF00106 * adh_short 2e-20 42.3 %
:HMM:PFM   4->169 PF00106 * adh_short 5.7e-30 27.0 159/167  
:HMM:PFM   181->245 PF01904 * DUF72 0.00081 26.0 50/230  
:BLT:SWISS 5->252 YDFG_SALTY 3e-41 39.5 %
:PROS 141->169|PS00061|ADH_SHORT
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56516.1 GT:GENE ACF56516.1 GT:PRODUCT oxidoreductase, short chain dehydrogenase/reductase family protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1740899..1741660) GB:FROM 1740899 GB:TO 1741660 GB:DIRECTION - GB:PRODUCT oxidoreductase, short chain dehydrogenase/reductase family protein GB:NOTE identified by match to protein family HMM PF00106 GB:PROTEIN_ID ACF56516.1 GB:DB_XREF GI:194358068 LENGTH 253 SQ:AASEQ MAKNVXITGATSGIGEAIARAYLEQGEDVVLTGRRIDRLEILKSEFAVSFPNQTVWTFPLXVTDMVMVKTVCSDILETIGRIDILVNNAGLALDLAPYQDYEELDMLTMLDTNVKGLMAVTRCFLPAMIKVNQGHIINMGSTAGIYAYAGAAVYSATKAAVKTFSDGLRIDTIATDIKVTTIQPGIVETDFSTVRFHGDKERAASVYQGIEALQAQDIADTVVYVTSQPRRVQITDMTIMANQQATGFMIHKK GT:EXON 1|1-253:0| BL:SWS:NREP 1 BL:SWS:REP 5->252|YDFG_SALTY|3e-41|39.5|243/248| PROS 141->169|PS00061|ADH_SHORT|PDOC00060| SEG 140->163|gstagiyayagaavysatkaavkt| BL:PDB:NREP 1 BL:PDB:REP 7->237|1xg5C|2e-21|30.9|230/257| RP:PDB:NREP 1 RP:PDB:REP 3->230|1a27A|8e-29|22.2|225/285| RP:PFM:NREP 1 RP:PFM:REP 7->139|PF00106|2e-20|42.3|130/169|adh_short| HM:PFM:NREP 2 HM:PFM:REP 4->169|PF00106|5.7e-30|27.0|159/167|adh_short| HM:PFM:REP 181->245|PF01904|0.00081|26.0|50/230|DUF72| GO:PFM:NREP 2 GO:PFM GO:0008152|"GO:metabolic process"|PF00106|IPR002198| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00106|IPR002198| RP:SCP:NREP 1 RP:SCP:REP 3->242|1xg5A|2e-30|30.5|236/254|c.2.1.2| HM:SCP:REP 1->244|1zemA1|6.1e-57|36.1|241/0|c.2.1.2|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 4257 OP:NHOMOORG 1020 OP:PATTERN --1---2-1111111--2---1--53333121-1---------1--23--312--1-----1111-24 6691A111112321BC655-5622DI54555BBCEC3ECC275572231521444315--32625588852-------1112-1-1112242-111---66C285a8E38111111111111112535475334534336611141C49855555---11-22-226B7E71-11111-1111742--13143555555565446545574665754343479945444539D13333332333333333346514134121118A22336553558453335656233555544544444543555554454455332555322435222222222231552365221---4211321----2322211-13312933311-11B2A26--33133512221122226-45341844AB71FBB5JBCKNCDB5666331141354433333333311351242---11111------11-----1-------32532634435CACCCA6344399EH444435DAD3B8C26687121321394A2575-33543222222213635226342--2---221-3212212112522AA12-1111111111111111111212-321462353756541223215232233354344--1-2121-----35873743443333333-4333333343433333334354553233333343333333334A33333331-3434544445651-14222224444195582224241221221339997A644744-574565C66A8985B8841111211113337444444532245533333333222---3114255--------1-2----2-1-2--------2-------2121113111341 ---1563----12335333644685783434443333423333222948C87EB78341212112142111111211-1111111151-46633A42222113644-344UCB75C44232665684B3Fa8-A7A4711843B43532282-6468CCSUI2EB9578975DBC2433K---1771283F52293464 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 252 STR:RPRED 99.6 SQ:SECSTR ccEEEEEcccccHHHHHHHHHHHTcTTccEEEEEEEccGGGTHHHHHTTccTTcEEEEEccTTcHHHHHHHHHTcTTHTccccEEEEccccccccccGGGccHHHHHHHHHHHTHHHHHHHHHHHHHHHHHTcEEEEEEEEGGGTcccTTcHHHHHHHHHHHHHHHHHHHHHGGGTEEEEEEEEccccccTTTTccccHHHHHHHccHHHHcccHHHHHHHHHHHHHcccEEEEEEEEEEEETTEEEEEEHH# DISOP:02AL 249-251,253-254| PSIPRED cccEEEEcccccHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHcccccEEEEEEEEEccHHHHHHHHHHHHHHHccccEEEEccccccccccHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEEcccccccHHHcccHHHHHHHHHHccccccccHHHHHHHHHHHHccccccEEccEEEEEcccHHHHHHccc //